DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1G and GstD6

DIOPT Version :9

Sequence 1:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:177 Identity:36/177 - (20%)
Similarity:81/177 - (45%) Gaps:20/177 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    20 IAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYV----- 79
            :..:::..||..        |......|.|::..|...:|... |:.|.::|:.||..|:     
  Fly    22 VGVEFNSIQVNT--------FVGEQLEPWFVKINPQHTIPTLV-DNLFVIWETRAIVVYLVEQYG 77

Human    80 SNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDA 144
            .::.|....|:..|.:.|.:.|....:....:.:.||   ::...|..|:...|::.....||:.
  Fly    78 KDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFP---LLRTGKPGTQENLEKLNAAFDLLNN 139

Human   145 YLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWF 191
            :|..:.::.|.::::|||.::.|:  ...::::...:: |||.:||:
  Fly   140 FLDGQDYVAGNQLSVADIVILATV--STTEMVDFDLKK-FPNVDRWY 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 13/66 (20%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 21/101 (21%)
tolA <212..>278 CDD:236545
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 277..381 CDD:395522
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 13/60 (22%)
PLN02395 11..208 CDD:166036 36/177 (20%)
GST_C_Delta_Epsilon 88..204 CDD:198287 21/102 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.