Sequence 1: | NP_001395.1 | Gene: | EEF1G / 1937 | HGNCID: | 3213 | Length: | 437 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287303.1 | Gene: | GstD9 / 41502 | FlyBaseID: | FBgn0038020 | Length: | 218 | Species: | Drosophila melanogaster |
Alignment Length: | 195 | Identity: | 45/195 - (23%) |
---|---|---|---|
Similarity: | 82/195 - (42%) | Gaps: | 25/195 - (12%) |
- Green bases have known domain annotations that are detailed below.
Human 6 LYTYPENWRAFKALIAAQYSGAQVRV----LSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDG 66
Human 67 FCVFESNAIAYYVSNE-----ELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQ 126
Human 127 ATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWF 191
Human 192 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
EEF1G | NP_001395.1 | GST_N_EF1Bgamma | 4..82 | CDD:239342 | 23/79 (29%) |
GST_C_EF1Bgamma_like | 91..213 | CDD:198290 | 20/101 (20%) | ||
tolA | <212..>278 | CDD:236545 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 221..268 | ||||
EF1G | 277..381 | CDD:395522 | |||
GstD9 | NP_001287303.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 23/78 (29%) |
GstA | 4..187 | CDD:223698 | 45/195 (23%) | ||
GST_C_Delta_Epsilon | 89..207 | CDD:198287 | 20/102 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |