DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1G and GstD9

DIOPT Version :9

Sequence 1:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:195 Identity:45/195 - (23%)
Similarity:82/195 - (42%) Gaps:25/195 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     6 LYTYPENWRAFKALIAAQYSGAQVRV----LSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDG 66
            ||:.|    ....|:.|:..|.::..    |.|..|.       .|||::..|...:|... |||
  Fly     8 LYSAP----CRSILMTARALGLELNKKQVDLDAGEHL-------KPEFVKINPQHTIPTLV-DDG 60

Human    67 FCVFESNAIAYYVSNE-----ELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQ 126
            |.::||.||..|::.:     .|....|:..|.:.|.:.|..|.:......:.:|.| .....|.
  Fly    61 FAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQL-FEDVKKP 124

Human   127 ATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWF 191
            |..:..:::.....:.:..||.:.:....::||||..::.|:...  ::.|..|.: :|...||:
  Fly   125 ADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTF--EISEYDFGK-YPEVVRWY 186

Human   192  191
              Fly   187  186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 23/79 (29%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 20/101 (20%)
tolA <212..>278 CDD:236545
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 277..381 CDD:395522
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 23/78 (29%)
GstA 4..187 CDD:223698 45/195 (23%)
GST_C_Delta_Epsilon 89..207 CDD:198287 20/102 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.