DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1G and GstE2

DIOPT Version :9

Sequence 1:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:201 Identity:55/201 - (27%)
Similarity:87/201 - (43%) Gaps:33/201 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    14 RAFKALIAA---QYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAI 75
            ||.|..:.|   .|...::.:| |..||       ...||:|.|...||..| |:|..:::|:||
  Fly    17 RACKLTLRALNLDYEYKEMDLL-AGDHF-------KDAFLKKNPQHTVPLLE-DNGALIWDSHAI 72

Human    76 AYYV-----SNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTL---GIMHHNKQATENAK 132
            ..|:     :::||........|||.|.: |.|:.|       :|.:|   .|.:..:|.:...|
  Fly    73 VCYLVDKYANSDELYPRDLVLRAQVDQRL-FFDASI-------LFMSLRNVSIPYFLRQVSLVPK 129

Human   133 EEVRRI---LGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTC 194
            |:|..|   .|.|:.:|....:|.|.::|:||:....|...| ..||:.. ...:|....||...
  Fly   130 EKVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSL-AAVLDLD-ELKYPKVAAWFERL 192

Human   195 INQPQF 200
            ...|.:
  Fly   193 SKLPHY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 22/75 (29%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 31/116 (27%)
tolA <212..>278 CDD:236545
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 277..381 CDD:395522
GstE2NP_611324.1 GstA 5..196 CDD:223698 54/197 (27%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/69 (32%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/115 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.