DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1G and GstE10

DIOPT Version :9

Sequence 1:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:219 Identity:53/219 - (24%)
Similarity:86/219 - (39%) Gaps:47/219 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    29 VRVLSAPPHFHF----GQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSN-----EEL 84
            :|.|.....||.    ...:..|:.|||.|...||..| |...|:::|:||..|:.|     :||
  Fly    22 LRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLE-DGESCIWDSHAIIGYLVNKYAQSDEL 85

Human    85 RGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHH-----------NKQATENAKE---EV 135
            ....|...|.|.|.:.|               ..|::.|           .:.|||..|:   |:
  Fly    86 YPKDPLKRAVVDQRLHF---------------ETGVLFHGIFKQLQRALFKENATEVPKDRLAEL 135

Human   136 RRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQF 200
            :....||:.:|....::.|.::|:||.::|.|:..|:.... |.....:|..:.|.......|.:
  Fly   136 KDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYC-PVDATKYPKLSAWLARISALPFY 199

Human   201 RA--VLGEVKLCEKM-----AQFD 217
            ..  :.|...|.:|:     .|||
  Fly   200 EEDNLRGARLLADKIRSKLPKQFD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 19/61 (31%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 27/137 (20%)
tolA <212..>278 CDD:236545 4/11 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 277..381 CDD:395522
GstE10NP_001286570.1 GstA 4..197 CDD:223698 46/191 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/55 (33%)
GST_C_Delta_Epsilon 91..211 CDD:198287 26/135 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.