DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1G and GstT4

DIOPT Version :9

Sequence 1:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:270 Identity:56/270 - (20%)
Similarity:108/270 - (40%) Gaps:85/270 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    32 LSAPPHFHFGQTNRTPEFLR-KFPAGKVPAFEG-----------------------------DDG 66
            :|.|..|:|...|::...|. ...|.|:| ||.                             |.|
  Fly     1 MSQPLKFYFDFLNQSSRALYILLEASKIP-FEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHG 64

Human    67 FCVFESNAIAYYVSNEELRGSTPE--------AAAQVVQWVSFADSDIVPPAST------WVFPT 117
            :.:.|:.||..:::.|:|   .||        ..:::.:::::..:: :..|:|      |:.|.
  Fly    65 YQLSENVAIFRHLAREKL---VPEHWYPRRHLGRSRIDEYLAWQQTN-MGVATTEYFQQKWLVPY 125

Human   118 LGIMHHNKQATENAKEEVRRILGLLD-AYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSF- 180
            |........|...|.:::...|...: .:|.:|.|::|:.::.||::.:|       ::.:|.. 
  Fly   126 LQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAIC-------EIDQPKSI 183

Human   181 -RQAFPNTN---RWFLTCINQ--PQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSRE 239
             ..||.|.|   ||:.|...:  |.::.||||         |:||            .|..||.:
  Fly   184 GYNAFQNRNKLARWYETVREELGPHYKEVLGE---------FEAK------------LKGSGSGQ 227

Human   240 EKQKPQAERK 249
            ::...||.::
  Fly   228 QQGVAQAVKQ 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 16/79 (20%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 28/135 (21%)
tolA <212..>278 CDD:236545 8/38 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268 5/29 (17%)
EF1G 277..381 CDD:395522
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 14/75 (19%)
GST_C_Theta 95..220 CDD:198292 31/153 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.