Sequence 1: | NP_001395.1 | Gene: | EEF1G / 1937 | HGNCID: | 3213 | Length: | 437 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572886.2 | Gene: | GstT4 / 32299 | FlyBaseID: | FBgn0030484 | Length: | 237 | Species: | Drosophila melanogaster |
Alignment Length: | 270 | Identity: | 56/270 - (20%) |
---|---|---|---|
Similarity: | 108/270 - (40%) | Gaps: | 85/270 - (31%) |
- Green bases have known domain annotations that are detailed below.
Human 32 LSAPPHFHFGQTNRTPEFLR-KFPAGKVPAFEG-----------------------------DDG 66
Human 67 FCVFESNAIAYYVSNEELRGSTPE--------AAAQVVQWVSFADSDIVPPAST------WVFPT 117
Human 118 LGIMHHNKQATENAKEEVRRILGLLD-AYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSF- 180
Human 181 -RQAFPNTN---RWFLTCINQ--PQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSRE 239
Human 240 EKQKPQAERK 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
EEF1G | NP_001395.1 | GST_N_EF1Bgamma | 4..82 | CDD:239342 | 16/79 (20%) |
GST_C_EF1Bgamma_like | 91..213 | CDD:198290 | 28/135 (21%) | ||
tolA | <212..>278 | CDD:236545 | 8/38 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 221..268 | 5/29 (17%) | |||
EF1G | 277..381 | CDD:395522 | |||
GstT4 | NP_572886.2 | GST_N_Theta | 5..80 | CDD:239348 | 14/75 (19%) |
GST_C_Theta | 95..220 | CDD:198292 | 31/153 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |