DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1G and GstE9

DIOPT Version :10

Sequence 1:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:203 Identity:53/203 - (26%)
Similarity:86/203 - (42%) Gaps:26/203 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    14 RAFKALIAA---QYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAI 75
            ||.|..:.|   ||....|.:|:.        .::|.||..|.|...||..| |||..::||:||
  Fly    16 RACKLTLDALGLQYEYRLVNLLAG--------EHKTKEFSLKNPQHTVPVLE-DDGKFIWESHAI 71

Human    76 -AY----YVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEV 135
             ||    |..:::|........|.|.|.:.|....:....    ...:.|....|..||..:.::
  Fly    72 CAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGC----IRNIAIPLFYKNITEVPRSQI 132

Human   136 RRI---LGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQ 197
            ..|   ...|:|::..:.:|.|..:|:||.:||.::..|..  |.....:.:|..|.|......|
  Fly   133 DAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVG--LAAIDAKRYPKLNGWLDRMAAQ 195

Human   198 PQFRAVLG 205
            |.::::.|
  Fly   196 PNYQSLNG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 26/75 (35%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 26/118 (22%)
tolA <212..>278 CDD:236545
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 277..381 CDD:459888
GstE9NP_725784.1 GstA 4..199 CDD:440390 52/197 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.