DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1G and GstT2

DIOPT Version :9

Sequence 1:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:212 Identity:55/212 - (25%)
Similarity:85/212 - (40%) Gaps:43/212 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    47 PEFLRKFPA-----------GKVPAFEGDDGFCVFESNAIAYYVS-----NEELRGSTPEAAAQV 95
            |..||||..           .||||..|.| |.:.|:.||..|::     :|:|...|.|..|:|
  Fly    34 PIALRKFEQLTDEYKKINRFQKVPAIVGGD-FHLSETIAIIRYLADKGQFDEKLYPKTLENRARV 97

Human    96 VQWVSFADSDIVPPAS-----TWVFPTLGIMHHNK-QATENAKEEVRRILGLLDAYLKTRTFLVG 154
            .:::.:...:|....|     .|:||..||....| :..:...|.|...||||:.......||||
  Fly    98 DEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVG 162

Human   155 ERVTLADITVVCTLLWLYKQVLEPSFR---QAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQF 216
            :.:|:|||.....:    .|:....:|   :.||...:|             |..|::.......
  Fly   163 KNLTMADILGSSEI----NQLRLCQYRVDEKKFPKVVKW-------------LERVRVSANPYHD 210

Human   217 DAKKFAETQPKKDTPRK 233
            :...|.:.:.|:.|..|
  Fly   211 EGLTFIDRKSKQSTAAK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 16/50 (32%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 31/130 (24%)
tolA <212..>278 CDD:236545 4/22 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268 4/13 (31%)
EF1G 277..381 CDD:395522
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 16/46 (35%)
GstA 7..202 CDD:223698 50/185 (27%)
GST_C_family 93..218 CDD:295467 32/141 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.