DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1D and eEF1delta

DIOPT Version :9

Sequence 1:NP_001123525.3 Gene:EEF1D / 1936 HGNCID:3211 Length:647 Species:Homo sapiens
Sequence 2:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster


Alignment Length:279 Identity:140/279 - (50%)
Similarity:176/279 - (63%) Gaps:31/279 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   373 AHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARARENIQKSLAGSSGPGASS 437
            |.:|.|.||.:||.||:||||   ||.....|..  .|.::.:||:|||:||.||....|.....
  Fly     5 ALDKFWADKSRYDLAEKRFYE---GPQKVTDRSH--YSPLVSEIAKAREHIQNSLEKIDGVTLDD 64

Human   438 GTSGDHGELVVRIASLEVENQSLRGVVQELQQ----AISKLEARLNVLEKSSPGHRATAPQTQHV 498
            |.   :.||..|:|.||.|::.|:..|..|.:    .:.:||.:|.:              |..|
  Fly    65 GL---NSELAKRLAQLEGEHKELKTQVSLLNELLTATVKRLETQLKL--------------TNGV 112

Human   499 SPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSS 563
            |...:||  ||||..   :|:|||:||||||:||||.|||::|||||..||.|||||..::|||:
  Fly   113 SKEPEVE--AKKPEA---NDDDDDVDLFGSDSEEEDGEAARIREERLAAYAAKKAKKVQIIAKSN 172

Human   564 ILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEE 628
            |:|||||||||||:..:|..:|.|..|||:|||||.|||.:||:||.|.||||||||..|.|.||
  Fly   173 IILDVKPWDDETDLKVMETEIRKITQDGLLWGASKFVPVAFGIQKLSISCVVEDDKVSIDWLTEE 237

Human   629 ITKFEEHVQSVDIAAFNKI 647
            |.|.|:.||||||||||||
  Fly   238 IEKLEDFVQSVDIAAFNKI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1DNP_001123525.3 EF-1_beta_acid 525..552 CDD:371151 19/26 (73%)
EF1_GNE 564..647 CDD:376378 56/82 (68%)
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 17/21 (81%)
EF1B 168..256 CDD:238181 59/87 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159543
Domainoid 1 1.000 67 1.000 Domainoid score I9800
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H23404
Inparanoid 1 1.050 234 1.000 Inparanoid score I3416
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49458
OrthoDB 1 1.010 - - D1464823at2759
OrthoFinder 1 1.000 - - FOG0001111
OrthoInspector 1 1.000 - - oto91605
orthoMCL 1 0.900 - - OOG6_106570
Panther 1 1.100 - - LDO PTHR11595
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X680
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.