DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and Rac1

DIOPT Version :9

Sequence 1:NP_001334459.1 Gene:Rac1 / 19353 MGIID:97845 Length:211 Species:Mus musculus
Sequence 2:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster


Alignment Length:211 Identity:176/211 - (83%)
Similarity:184/211 - (87%) Gaps:19/211 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYD 65
            |||||||||||||||||||||||||||||||||||||||||||||||.||:||||||||||||||
  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65

Mouse    66 RLRPLSYPQTVGDTCGKDRPSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPII 130
            ||||||||||                   ||||||||||:||||||||||||||||||||:||||
  Fly    66 RLRPLSYPQT-------------------DVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPII 111

Mouse   131 LVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAV 195
            ||||||||||||:|||||::|||.|||||||||||||||||||||||||||:|||||||||||:|
  Fly   112 LVGTKLDLRDDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSV 176

Mouse   196 LCPPPVKKRKRKCLLL 211
            |||....|.||||.||
  Fly   177 LCPVLQPKSKRKCALL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001334459.1 None
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 145/172 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 342 1.000 Domainoid score I1070
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69035
Inparanoid 1 1.050 366 1.000 Inparanoid score I2142
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 1 1.000 - - mtm8725
orthoMCL 1 0.900 - - OOG6_100633
Panther 1 1.100 - - LDO PTHR24072
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2743
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.