Sequence 1: | NP_083667.1 | Gene: | Rab4b / 19342 | MGIID: | 105071 | Length: | 213 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477170.1 | Gene: | Rab11 / 42501 | FlyBaseID: | FBgn0015790 | Length: | 214 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 97/206 - (47%) |
---|---|---|---|
Similarity: | 125/206 - (60%) | Gaps: | 19/206 - (9%) |
- Green bases have known domain annotations that are detailed below.
Mouse 3 ETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQ 67
Mouse 68 ERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVT 132
Mouse 133 FLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGDISLRQL 197
Mouse 198 RQPRSAQAVAP 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab4b | NP_083667.1 | Rab4 | 9..169 | CDD:206696 | 85/159 (53%) |
Effector region. /evidence=ECO:0000250 | 37..45 | 5/7 (71%) | |||
Rab11 | NP_477170.1 | Rab11_like | 9..173 | CDD:206660 | 90/182 (49%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |