DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4b and Rab11

DIOPT Version :9

Sequence 1:NP_083667.1 Gene:Rab4b / 19342 MGIID:105071 Length:213 Species:Mus musculus
Sequence 2:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster


Alignment Length:206 Identity:97/206 - (47%)
Similarity:125/206 - (60%) Gaps:19/206 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 ETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQ 67
            :.||:|||.::||.:|.|||.||.:|..|:|..:|..||||||.:|.:.|.|||:|.||||||||
  Fly     6 DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQ 70

Mouse    68 ERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVT 132
            ||:|::|.:|||||.||||||||....||.::..||.:.|..|..|||::|.|||.||...|.|.
  Fly    71 ERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVP 135

Mouse   133 FLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGDISLRQL 197
            ..||..||:.|.|.|:|||||...|||.||    :.||.:|               |..:|.:|:
  Fly   136 TDEAKLFAERNGLSFIETSALDSTNVETAF----QNILTEI---------------YRIVSQKQI 181

Mouse   198 RQPRSAQAVAP 208
            |.|.....:.|
  Fly   182 RDPPEGDVIRP 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4bNP_083667.1 Rab4 9..169 CDD:206696 85/159 (53%)
Effector region. /evidence=ECO:0000250 37..45 5/7 (71%)
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 90/182 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.