DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab33a and Rab19

DIOPT Version :9

Sequence 1:XP_036017751.1 Gene:Rab33a / 19337 MGIID:109493 Length:258 Species:Mus musculus
Sequence 2:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster


Alignment Length:127 Identity:59/127 - (46%)
Similarity:80/127 - (62%) Gaps:19/127 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse   108 VQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGN 172
            :|:|||||||||| ::.:.|||:.:.|:.|||:||.:||:||:.||:|...:....:: .:||||
  Fly    72 LQIWDTAGQERFR-TITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVL-IILVGN 134

Mouse   173 KCDLREQIQVPSNLALKFADAHNM------LLF--ETSAKDPKESQNVESIFMCLACRLKAQ 226
            ||||.||.:|      .|.:|..|      :||  ||||   ||:.|||..|.|||..||.|
  Fly   135 KCDLEEQREV------DFEEARQMCQYIPEILFVMETSA---KENMNVEDAFRCLANELKRQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab33aXP_036017751.1 P-loop_NTPase <108..225 CDD:422963 57/124 (46%)
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 56/122 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.