DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1B2 and eEF1delta

DIOPT Version :9

Sequence 1:NP_001032752.1 Gene:EEF1B2 / 1933 HGNCID:3208 Length:225 Species:Homo sapiens
Sequence 2:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster


Alignment Length:129 Identity:85/129 - (65%)
Similarity:103/129 - (79%) Gaps:0/129 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    97 DDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEEC 161
            ||||:||||||.|||..||.|:||||||.|.:|||||..::|||:|:|||||||||||:..:|..
  Fly   128 DDDDVDLFGSDSEEEDGEAARIREERLAAYAAKKAKKVQIIAKSNIILDVKPWDDETDLKVMETE 192

Human   162 VRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI 225
            :|.|..|||:||:||.|||.:||:||.|.||||||||..|.|.|:|...||:|||:|:||||||
  Fly   193 IRKITQDGLLWGASKFVPVAFGIQKLSISCVVEDDKVSIDWLTEEIEKLEDFVQSVDIAAFNKI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1B2NP_001032752.1 GST_C_eEF1b_like <3..62 CDD:198341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..115 13/17 (76%)
EF-1_beta_acid 103..130 CDD:402289 18/26 (69%)
EF1_GNE 142..225 CDD:395597 52/82 (63%)
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 16/21 (76%)
EF1B 168..256 CDD:238181 55/87 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159541
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1464823at2759
OrthoFinder 1 1.000 - - FOG0001111
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X680
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.