DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11b and Rab14

DIOPT Version :9

Sequence 1:XP_030105459.1 Gene:Rab11b / 19326 MGIID:99425 Length:278 Species:Mus musculus
Sequence 2:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster


Alignment Length:167 Identity:86/167 - (51%)
Similarity:115/167 - (68%) Gaps:0/167 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    75 VLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSA 139
            ::|||.|||||.||.:||..:|......||||||.||.|:||.|.||.||||||||||:||:|.:
  Fly    39 IIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRS 103

Mouse   140 YYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAE 204
            |||||.|||:||||.:..||.::..||.:.|:..:.:.||.|:||||||...|.|..:||:.||:
  Fly   104 YYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFAD 168

Mouse   205 KNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQI 241
            :|.|.|:|.||:...||||||.....:||:.:.:.::
  Fly   169 ENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11bXP_030105459.1 Rab11_like 74..233 CDD:206660 84/157 (54%)
Rab14NP_788056.1 Rab14 34..199 CDD:133322 86/159 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.