DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab19

DIOPT Version :9

Sequence 1:NP_057885.1 Gene:Rab10 / 19325 MGIID:105066 Length:200 Species:Mus musculus
Sequence 2:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster


Alignment Length:199 Identity:85/199 - (42%)
Similarity:125/199 - (62%) Gaps:5/199 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 YDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER 70
            :|.|||::||||.|.||||::.||....:.....:|||:||.:||:.::||:|||||||||||||
  Fly    18 FDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQER 82

Mouse    71 FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKG 135
            |.|||.||||.|.|:::|||||...||.|:.||:..:..:...:|..:|:|||||::::|.|...
  Fly    83 FRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREVDFE 147

Mouse   136 KGEQIAR--EHGIRFFETSAKANINIEKAFLTLAEDILRK---TPVKEPNSENVDISSGGGVTGW 195
            :..|:.:  ...:...|||||.|:|:|.||..||.::.|:   ..|:|.....:.:..|..:...
  Fly   148 EARQMCQYIPEILFVMETSAKENMNVEDAFRCLANELKRQHDANNVEEVPENTITLGQGKPLKSC 212

Mouse   196 KSKC 199
            .|.|
  Fly   213 SSSC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_057885.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 79/167 (47%)
Effector region. /evidence=ECO:0000250 38..46 3/7 (43%)
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 79/164 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.