DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Qk and qkr58E-1

DIOPT Version :9

Sequence 1:NP_001152989.1 Gene:Qk / 19317 MGIID:97837 Length:341 Species:Mus musculus
Sequence 2:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster


Alignment Length:320 Identity:88/320 - (27%)
Similarity:145/320 - (45%) Gaps:83/320 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 ETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHL--ERLLDEEISRV-------RKDMYNDTL 61
            :|.:..:.|..||.:.:.:||.:..        .|:  :||||:|:.::       :.::|   .
  Fly    50 DTPQLNEKTNAYLQECLLEKKTLEK--------KHIITKRLLDDEVEKILVSGRIPKPEIY---A 103

Mouse    62 NGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGK 126
            |..:||          || ::.:|:..|:||||.|||||:||||:|.|.:||:.||.||::|.|:
  Fly   104 NVYSEK----------PI-RVAQKVLFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGR 157

Mouse   127 GSMRDKKKEEQNR--GKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSL 189
            .||||..|||:.|  |.|.:.||:.||||.|:.......|..::..|:.|::|.::|  :..|.:
  Fly   158 NSMRDHGKEEELRSSGNPKYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKFMIP--DANDDI 220

Mouse   190 KKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAG--PTIM 252
            :..||.|:......|:.::..|.:.....|.::                   |||.||.  |.:.
  Fly   221 RLEQLREMDGKERMYKKSHHYSKSYGDHGAYSS-------------------RTPPPASSKPKVY 266

Mouse   253 PLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYT-------------PYEYPYTLAPATS 299
            .::.:              |..|...|..|::.|             .|:...|..|.||
  Fly   267 SILEK--------------ARYVMDDPNYGIVKTHRSRDHELYDHHGEYDRYATPPPQTS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QkNP_001152989.1 STAR_dimer 10..66 CDD:406848 13/64 (20%)
Qua1 domain, involved in homodimerization. /evidence=ECO:0000250|UniProtKB:Q17339 11..82 17/79 (22%)
KH-I_Hqk 81..183 CDD:411893 47/103 (46%)
Qua2 domain, involved in RNA binding. /evidence=ECO:0000250|UniProtKB:Q96PU8 182..213 6/30 (20%)
PHA03247 <211..314 CDD:223021 18/104 (17%)
SH3-binding 276..279 0/2 (0%)
Quaking_NLS 312..341 CDD:406855
Nuclear localization signal 324..330
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 48/111 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1833
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.