DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvalb and Eip63F-1

DIOPT Version :9

Sequence 1:NP_001317615.1 Gene:Pvalb / 19293 MGIID:97821 Length:110 Species:Mus musculus
Sequence 2:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster


Alignment Length:129 Identity:34/129 - (26%)
Similarity:58/129 - (44%) Gaps:27/129 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MSMTDVLSAEDIKKAIGAFAAADSFDHKKFFQMVG--------------LKKKNP-DEVKKV--- 47
            ::::|.|..:.|::|  :.:.....:..:|.|.||              .|...| ||...|   
  Fly    69 INVSDELIHDLIREA--SHSGNGLINEAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTED 131

Mouse    48 ----FHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLLAAGDKDGDGKIGVEEFSTLV 107
                |.:.|:|.:|||..|||.:.::..   ...|:.::.:.||...|.|.||:|..|||:.|:
  Fly   132 LIAAFRVFDRDGNGFITRDELQTAMEMI---GEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PvalbNP_001317615.1 EFh_parvalbumin_alpha 9..109 CDD:319997 32/121 (26%)
EF-hand motif 9..38 CDD:319997 6/42 (14%)
EF-hand motif 43..72 CDD:319997 11/35 (31%)
EF-hand motif 82..109 CDD:319997 11/26 (42%)
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 34/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.