DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptprr and Ptp61F

DIOPT Version :9

Sequence 1:NP_035347.1 Gene:Ptprr / 19279 MGIID:109559 Length:656 Species:Mus musculus
Sequence 2:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster


Alignment Length:287 Identity:88/287 - (30%)
Similarity:144/287 - (50%) Gaps:21/287 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse   372 SASRVLTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEI---DIPRHGTK--NRYKTILPNPLSRV 431
            :|:|:...::.:|.....|....|..|........|:.   :..||..:  |||:.:.|...||:
  Fly    13 AAARLQIEAEYKDKGPQWHRFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRI 77

Mouse   432 CLRPKNITDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQEDSPVIVMITKLKEK 496
            .|:..::     .|||||.:: ....|:.:|.||||:::||..||.|||::.|..::|:.||.||
  Fly    78 VLKRGSV-----DYINANLVQ-LERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEK 136

Mouse   497 NE-KCVLYWPEKRGI-------YGKVEVLVTGVTECDNYTIR--NLVLKQGSHTQHVKHYWYTSW 551
            .: ||.||||.:.|.       :.|:.|.:..:....|:..|  .|...:...::.|..:.||:|
  Fly   137 KQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTW 201

Mouse   552 PDHKTPDSAQPLLQLMLDVEEDRLASEGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDAL 616
            ||...|.|....|:.:..|.:....|...||.||||||||||:|.|.........:.:.|..:..
  Fly   202 PDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVS 266

Mouse   617 SIVCQLRVDRGGMVQTSEQYEFVHHAL 643
            .::|:||..|.|::||::|.:|.:.|:
  Fly   267 KVLCELRSYRMGLIQTADQLDFSYQAI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtprrNP_035347.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..289
PTPc 391..643 CDD:214550 83/266 (31%)
PTPc 416..643 CDD:238006 78/238 (33%)
Substrate binding. /evidence=ECO:0000250 587..593 5/5 (100%)
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 84/266 (32%)
PTPc 62..295 CDD:238006 79/238 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.