DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptprm and Ptp61F

DIOPT Version :9

Sequence 1:NP_001344554.1 Gene:Ptprm / 19274 MGIID:102694 Length:1486 Species:Mus musculus
Sequence 2:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster


Alignment Length:307 Identity:100/307 - (32%)
Similarity:160/307 - (52%) Gaps:28/307 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse   952 AKKDENRMKNRYGNIIAYDHSRVRLQMLEGDNNSDYINGNYIDGYHRPNHYIATQGPMQETIYDF 1016
            :::..||..|||.::..|||||:.|:.    .:.||||.|.:........||.||||:.:|:..|
  Fly    55 SERHTNRGLNRYRDVNPYDHSRIVLKR----GSVDYINANLVQLERAERQYILTQGPLVDTVGHF 115

Mouse  1017 WRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYKDIK-------VTLIDTELLAEYVIRTF 1074
            |.|||.:.:.:::|:..|:|..::||..|||::....|.:|       |.|:..|....:|.|.|
  Fly   116 WLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQNFVRRWF 180

Mouse  1075 AVEKRGIHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQVKSKS--PPNAGPLVVHCSAGAGRTG 1137
            .:......:.||:.|||:|.|||.|:|......|.|::||:...  ..:.||.|||||||.||:|
  Fly   181 KLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSG 245

Mouse  1138 CFIVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTSIPASQVR 1202
            .|.::|..|.:.::.|..::...:.||||.|:.::||.:|..|.:.||:|.            ::
  Fly   246 TFCLVDCCLVLIDKYGECNVSKVLCELRSYRMGLIQTADQLDFSYQAIIEG------------IK 298

Mouse  1203 SLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTL--RVEDCSIALLPRN 1247
            .| :|...||.:........|..||:.:.|.|  ||:..::.|.|.:
  Fly   299 KL-HDPTFLDAEEPLISNDTETHTLDELPPPLPPRVQSLNLPLAPNS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtprmNP_001344554.1 MAM 22..182 CDD:214533
ig 192..274 CDD:278476
FN3 282..361 CDD:214495
FN3 383..467 CDD:214495
fn3 499..574 CDD:306538
PTPc 933..1187 CDD:214550 86/243 (35%)
PTPc 1249..1481 CDD:238006
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 86/243 (35%)
PTPc 62..295 CDD:238006 84/236 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.