DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpn2 and PTP-ER

DIOPT Version :9

Sequence 1:NP_001120649.1 Gene:Ptpn2 / 19255 MGIID:97806 Length:406 Species:Mus musculus
Sequence 2:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster


Alignment Length:474 Identity:88/474 - (18%)
Similarity:139/474 - (29%) Gaps:222/474 - (46%)


- Green bases have known domain annotations that are detailed below.


Mouse    21 LYLEIRNESHDYPHRVAKFP---ENRNRNRYRDVSPYDHSRVKLQSTEND--------------- 67
            ::.::..|..|.|....:.|   .::.:|||:.:.|.::|||.|:|..::               
  Fly   891 IFRDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVT 955

Mouse    68 ------YINASLV-DIEEAQRSYILTQGPLPNTCCHFWLMVW----------------------- 102
                  ||||:.: ..:...:.|:.||||||||...||||::                       
  Fly   956 ASEDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDR 1020

Mouse   103 ----QQKTKAVVMLNRTVEKESVKCAQYWPTDDREMVFKETGFSVKLLSEDVKSYYTVHL----- 158
                ||..:.:|||....|....|||.|:|.:..|:........|..||...:.|:..:|     
  Fly  1021 EQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFV 1085

Mouse   159 -------------------LQLENI----------------------NTGETRT----------- 171
                               :.:|::                      |.|..|.           
  Fly  1086 PDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLL 1150

Mouse   172 -----------------ISHFHYTTWPDFGVPESPASFLNFLFKVRESGCLTPD----------- 208
                             ..|:.|..|||...|....:.|:....|...|....:           
  Fly  1151 YCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSER 1215

Mouse   209 --HGPA------------------VIHCSAGIGRSGTFSLV------------------------ 229
              |..|                  ||||||||||:|.|:.:                        
  Fly  1216 NAHLAAQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLT 1280

Mouse   230 ----------------DTCLVL-----------------------MEKGED--VNVKQLLLNMRK 253
                            .||..:                       :.|..|  |:|..::.|:|.
  Fly  1281 SSSTEEYHNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRL 1345

Mouse   254 YRMGLIQTPDQLRFSYMAI 272
            .|.|::|..:|....:.||
  Fly  1346 QRGGMVQNSEQYELIHRAI 1364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpn2NP_001120649.1 PTPc 5..274 CDD:214550 88/474 (19%)
PTPc 45..274 CDD:238006 84/447 (19%)
Substrate binding. /evidence=ECO:0000250 216..222 5/5 (100%)
Endoplasmic reticulum location. /evidence=ECO:0000250 341..406
Mediates interaction with STX17. /evidence=ECO:0000250 371..406
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 82/447 (18%)
PTPc 917..1364 CDD:238006 82/446 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.