Sequence 1: | NP_035336.2 | Gene: | Ptpn18 / 19253 | MGIID: | 108410 | Length: | 453 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_726092.1 | Gene: | PTP-ER / 37461 | FlyBaseID: | FBgn0016641 | Length: | 1377 | Species: | Drosophila melanogaster |
Alignment Length: | 515 | Identity: | 101/515 - (19%) |
---|---|---|---|
Similarity: | 166/515 - (32%) | Gaps: | 234/515 - (45%) |
- Green bases have known domain annotations that are detailed below.
Mouse 1 MSRHTDLVRSFLEQLEARDYREGAILAREFSDIKARSVAWKSEGVCSTKAGSRLGNTNKNRYKDV 65
Mouse 66 VAYDETRVIL--------SLLQEEGHGD---------YINANFIRGID-GSQAYIATQGPLPHTL 112
Mouse 113 LDFWRLVW----------------------------EFGVKVILMACQETENGRRKCERYWAREQ 149
Mouse 150 EPL-----KAGPFCI--------------TLTKETTLNAD-----------ITLRTLQVTFQKEF 184
Mouse 185 -----------------------RSVHQL------------------------QYMSWPDHGVPS 202
Mouse 203 SSD-------HILTM---------------------------VEEARCLQGLGPGPLCVHCSAGC 233
Mouse 234 GRTGVLCAV-DYVRQL----------LLTQTI--------------------------------- 254
Mouse 255 -------PPNF-----------SLFQVVLEMRKQRPAAVQTEEQYRFLYHTVAQLFSRTL 296 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ptpn18 | NP_035336.2 | Y_phosphatase | 56..290 | CDD:278528 | 88/452 (19%) |
PTPc | 59..290 | CDD:238006 | 88/449 (20%) | ||
Substrate binding. /evidence=ECO:0000250 | 229..235 | 4/5 (80%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 384..453 | ||||
PTP-ER | NP_726092.1 | Y_phosphatase | 916..1364 | CDD:278528 | 88/449 (20%) |
PTPc | 917..1364 | CDD:238006 | 88/448 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0789 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |