DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31381 and IPT6

DIOPT Version :9

Sequence 1:NP_001189283.1 Gene:CG31381 / 192528 FlyBaseID:FBgn0043799 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_173912.1 Gene:IPT6 / 839127 AraportID:AT1G25410 Length:342 Species:Arabidopsis thaliana


Alignment Length:383 Identity:98/383 - (25%)
Similarity:162/383 - (42%) Gaps:94/383 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVPLIVVLGSTGTGKTKLSLQLAER-FGGEIISADSMQVYTHLDIATAKATKEEQSRARHHLLDV 67
            |..::::.|:|||||::||:.||.| |..|||::|.||:|...:|.|......||....||||..
plant    44 KDKVVLITGTTGTGKSRLSVDLATRFFPAEIINSDKMQIYKGFEIVTNLIPLHEQGGVPHHLLGQ 108

  Fly    68 ATPAE-PFTVTHFRNAALPIVERLLAKDTSPIVVGGTNYYIESLLWDILVDSDVKPDEGKHSGEH 131
            ..|.: ..|...||:.|...:.:|::....||||||:|.:..:||                    
plant   109 FHPQDGELTPAEFRSLATLSISKLISSKKLPIVVGGSNSFNHALL-------------------- 153

  Fly   132 LKDAELNALSTLELHQHLAKIDAGSANRIHPNNRRKIIRAIEVYQSTGQTLSQMLAEQRAQPGGN 196
                                     |.|..|:        |:.: |.|.:||.:.::        
plant   154 -------------------------AERFDPD--------IDPF-SPGSSLSTICSD-------- 176

  Fly   197 RLGGPLRYPHIVLLWLRCQQDVLNERLDSRVDGMLAQGLLPELRQFHNAHHATTVQAYTSGVLQT 261
                 ||| ...:||:...:.||.:.|.:|||.|:..||:.:|.:.::   .........||.:|
plant   177 -----LRY-KCCILWVDVLEPVLFQHLCNRVDQMIESGLVEQLAELYD---PVVDSGRRLGVRKT 232

  Fly   262 IGYKEFIPYLIKYDQQQDEKIEEYLKTHSYKLPGPEKLKEEGLPDGLELLRNCCEELKLVTRRYS 326
            ||.:||..|...|.::.|:.|.:..:..:|:    |.:|  |:.:     |.|    :|| ::..
plant   233 IGVEEFDRYFRVYPKEMDKGIWDLARKAAYE----ETVK--GMKE-----RTC----RLV-KKQK 281

  Fly   327 KKQLKWINNRF-LASKDRQVPDLYELDTSDVSAWQVAVYKRAETIIESYRNEEACEIL 383
            :|.:|.|...: :...|.....:.||:.|...    ...|....|.|.:..:|:.||:
plant   282 EKIMKLIRGGWEIKRLDATAAIMAELNQSTAK----GEGKNGREIWEKHIVDESVEIV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31381NP_001189283.1 PLN02748 1..446 CDD:215399 98/383 (26%)
miaA 4..337 CDD:234626 88/334 (26%)
zf-C2H2_jaz 401..426 CDD:288983
IPT6NP_173912.1 PLN02165 1..342 CDD:177823 98/383 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1003231at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11088
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.