DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31381 and IPT5

DIOPT Version :9

Sequence 1:NP_001189283.1 Gene:CG31381 / 192528 FlyBaseID:FBgn0043799 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001318596.1 Gene:IPT5 / 832023 AraportID:AT5G19040 Length:330 Species:Arabidopsis thaliana


Alignment Length:397 Identity:99/397 - (24%)
Similarity:158/397 - (39%) Gaps:143/397 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKVPLIVVLGSTGTGKTKLSLQLAERFGGEIISADSMQVYTHLDIATAKATKEEQSRARHHLL-D 66
            ||..::.|:|:|||||::|::.||.||..||:::|.:|||..|||.|.|.|.||.....|||| .
plant    31 RKDKVVFVMGATGTGKSRLAIDLATRFPAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGT 95

  Fly    67 VATPAEPFTVTHFRNAALPIVERLLAKDTSPIVVGGTNYYIESLLWDILVDSDVKPDEGKHSGEH 131
            |....|.||...|:..|:..||.::.:|..||:.||:|.|||:|:.|.:   |.:          
plant    96 VHDTYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSNSYIEALVNDCV---DFR---------- 147

  Fly   132 LKDAELNALSTLELHQHLAKIDAGSANRIHPNNRRKIIRAIEVYQSTGQTLSQMLAEQRAQPGGN 196
                                                                             
plant   148 ----------------------------------------------------------------- 147

  Fly   197 RLGGPLRYPHIVLLWLRCQQDVLNERLDSRVDGMLAQGLLPELRQFHNAHHATTVQAYTSGVLQT 261
                 ||| :...||:...:.||:..:..|||.|:..||:.|:|:..:...:.    |::|:.:.
plant   148 -----LRY-NCCFLWVDVSRPVLHSFVSERVDKMVDMGLVDEVRRIFDPSSSD----YSAGIRRA 202

  Fly   262 IGYKEFIPYLIKYDQQQDEKIEEYLKT--HSYKLPGPEKLKE---EGLPDGLELLRNCCEELKLV 321
            ||..|               ::|:|::  .:|.....|:|.|   |.:.:...||  .|.:|:.:
plant   203 IGVPE---------------LDEFLRSEMRNYPAETTERLLETAIEKIKENTCLL--ACRQLQKI 250

  Fly   322 TRRYSKKQLKWINNRFLASKDRQVPDLYELDTSDVSAWQVAVYKRAETIIESYRNEEACEILPMA 386
            .|.|  ||.||              :::.:|.::|      ..:|.|...|::.|..|       
plant   251 QRLY--KQWKW--------------NMHRVDATEV------FLRRGEEADEAWDNSVA------- 286

  Fly   387 KREHPGA 393
               ||.|
plant   287 ---HPSA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31381NP_001189283.1 PLN02748 1..446 CDD:215399 99/397 (25%)
miaA 4..337 CDD:234626 88/338 (26%)
zf-C2H2_jaz 401..426 CDD:288983
IPT5NP_001318596.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I4778
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1003231at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11088
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.