DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dusp1 and puc

DIOPT Version :9

Sequence 1:NP_038670.1 Gene:Dusp1 / 19252 MGIID:105120 Length:367 Species:Mus musculus
Sequence 2:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster


Alignment Length:222 Identity:83/222 - (37%)
Similarity:117/222 - (52%) Gaps:34/222 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse   131 SCPELCSKQSTPTGLS----LPLSTSVPDSAESGCSSCSTP-LYD-QGGPVE-ILSFLYLGSAYH 188
            :|.|:.|..|:.|.::    .|..|          .|||:| :|| :..|.. :...|.||:...
  Fly    94 ACDEVTSTTSSSTAMNGGGRTPALT----------RSCSSPAVYDIETHPASPVFPHLLLGNGRD 148

Mouse   189 ASRKDMLDALGITALINVSANCPN--HFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKDAG 251
            |   |...::|...::||:...||  |.:| .:|..||..|....:|..:|.||.|||:..:..|
  Fly   149 A---DDPSSVGANCVLNVTCQSPNESHLQG-LKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTG 209

Mouse   252 GRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFE-----SQ 311
            .||.:||.|||||||||.:||:||...:.|.||::.||..|.|||||.:||||||:.|     |.
  Fly   210 SRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSG 274

Mouse   312 VLA---PHCSAEAGSPAMAVLDRGTST 335
            |||   ||.::.:...:.:|   |.||
  Fly   275 VLAPATPHLNSPSNPSSSSV---GLST 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dusp1NP_038670.1 DSP_MapKP 7..136 CDD:238723 2/4 (50%)
DSPc 173..309 CDD:238073 59/138 (43%)
CDC14 188..313 CDD:225297 57/131 (44%)
pucNP_524273.1 DSPc 133..267 CDD:238073 59/137 (43%)
CDC14 <193..272 CDD:225297 42/78 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.