DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dusp1 and CG10089

DIOPT Version :9

Sequence 1:NP_038670.1 Gene:Dusp1 / 19252 MGIID:105120 Length:367 Species:Mus musculus
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:169 Identity:47/169 - (27%)
Similarity:80/169 - (47%) Gaps:4/169 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse   176 EILSFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA 240
            ::|..||:|:...:.....|:...|:.:|.:. :.|........|..:...|....::|.:|:..
  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIH-DSPRRLLPDKHYLCVMASDTPDQNLSQYFSVC 70

Mouse   241 IDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQL 305
            .|||.:.:...|.|.:||.||:|||.|:.:||:|....:...||.:.|:..|::.:||..|..||
  Fly    71 NDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQL 135

Mouse   306 LQFESQVLAP---HCSAEAGSPAMAVLDRGTSTTTVFNF 341
            .:||...|:.   .......|.|:..|||....|.:.|:
  Fly   136 QEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dusp1NP_038670.1 DSP_MapKP 7..136 CDD:238723
DSPc 173..309 CDD:238073 37/132 (28%)
CDC14 188..313 CDD:225297 35/124 (28%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 37/132 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.