DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12084 and Y55F3C.9

DIOPT Version :9

Sequence 1:NP_612112.1 Gene:CG12084 / 192509 FlyBaseID:FBgn0043458 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_001343666.1 Gene:Y55F3C.9 / 3896809 WormBaseID:WBGene00044459 Length:732 Species:Caenorhabditis elegans


Alignment Length:504 Identity:105/504 - (20%)
Similarity:186/504 - (36%) Gaps:134/504 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TLKEIAYQKLC---NNLDIISS---HRPDGQRGLNPGIVLPNEICDGFLENYQRFNRPLDDSVIR 77
            :|..||.:::.   ||.|.|.|   .|.|.|.            |:....|..:.| |....||.
 Worm   231 SLSNIAAERIAKYMNNGDYIISKAVERMDAQS------------CEVVFSNLLKLN-PSQSGVIA 282

  Fly    78 LFEDTHRTSLKIVNLRNSTLSSIGL---ETLMRH--KLFALSLWYCDMISVGSHHLLAHYGDSLR 137
            ..            .:|.:|.|:.|   :.::::  |:..:.|..| :::..|.       .:|:
 Worm   283 EV------------CKNRSLHSLILGKKKKILKYGKKIDVVCLIDC-IVNENSR-------TTLK 327

  Fly   138 SLELGISSHLLQYAEPNEKEPVDFQLTCPHLRRLVLNGVVMHHR---LQFAHLHDLGHLDLTSCV 199
            ||::..|..:|:...|   |.:...|  |.|...:|:|..:...   |......:|..||::...
 Worm   328 SLDISKSEQILRQGWP---EKIADML--PSLTTFILSGKKLTENEMTLLIKSFPNLSCLDISDTN 387

  Fly   200 LANFS-------LEALGSLPNLHTLILFNVWPIANQLHAICCLRRLCTLDISISSSGNGHGTYDL 257
            :.|.:       |:.| |:.|||    ||.|   ..:..:..|:.|..||:|       |..|:.
 Worm   388 IKNLNGISNLTHLQVL-SMRNLH----FNTW---FDMMDLFNLKNLTFLDVS-------HDHYNT 437

  Fly   258 PDQTLEMLM---DNLRHLTHLDISGTNLAGNGVATKESTTTSGMQQSPKMEQHFAL------TDI 313
            ..:|::..:   .::..|..||.:.|:|       .::...|.|:..|.:::..||      :.|
 Worm   438 GIKTMQQFIGCGKSIEKLAFLDCTSTDL-------NDNLLNSLMESHPNLQKITALNCLVQYSKI 495

  Fly   314 P--------GLASRTQRPLQFLGLYHTAH-WACKRHDIPALEVAGDANEQQIL------------ 357
            |        .:.|..:....|..|...|. ..|....:..|..|.:.||:..|            
 Worm   496 PELQVLNMESIGSSLKSLSYFTSLKREASVLRCLTRILFLLRQAHERNEEYDLIGCMMKIIEVIE 560

  Fly   358 ----TAA---RY--YHDRPVLLTRVLNDLYHLFRFENCKDIHTALDVVLSAMDRHLKF-----KH 408
                |:|   ||  |.:....||.:..:..|.|   :..|:...||:.|:.:|:....     :|
 Worm   561 TFPSTSANNLRYSIYMECVNCLTEISGNKSHQF---HSLDVSLVLDIFLNYIDKMTSVDSFFGEH 622

  Fly   409 MQISGSATLFYIV----KGRDRSKFGALLRNHIIRTLL--NGMEMHITD 451
            ..|.....:..::    .|.:..|.|.:....:|:|.:  |..:.|..|
 Worm   623 PCIPVWTAILNMIDLDLPGLNYDKIGGMAIQFLIKTAVAQNFFQCHALD 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12084NP_612112.1 leucine-rich repeat 110..135 CDD:275381 3/24 (13%)
leucine-rich repeat 136..167 CDD:275381 8/30 (27%)
leucine-rich repeat 168..189 CDD:275381 4/23 (17%)
leucine-rich repeat 190..213 CDD:275381 7/29 (24%)
ARM 535..628 CDD:237987
Y55F3C.9NP_001343666.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.