DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12084 and C06C3.4

DIOPT Version :9

Sequence 1:NP_612112.1 Gene:CG12084 / 192509 FlyBaseID:FBgn0043458 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_495996.3 Gene:C06C3.4 / 174485 WormBaseID:WBGene00007375 Length:226 Species:Caenorhabditis elegans


Alignment Length:96 Identity:20/96 - (20%)
Similarity:29/96 - (30%) Gaps:26/96 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   700 IKSERNINYRSFEPILSLVRCYETPQCQHW---------AVWALANLTQVYPEKYCKLVEQENGI 755
            |..:.|...|.|...:.....|...||.|.         .:|.    |::.|       ......
 Worm   123 INDQLNTGTRDFSHSIVADLVYRGWQCWHQYDLKRTLVDLLWK----TEICP-------FSSTDF 176

  Fly   756 QILNELIEHESPYCEIKRIARLVIEQCDSGS 786
            .::....|.|...||..      ||||.:|:
 Worm   177 PVITRKTECEECSCECG------IEQCSNGA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12084NP_612112.1 leucine-rich repeat 110..135 CDD:275381
leucine-rich repeat 136..167 CDD:275381
leucine-rich repeat 168..189 CDD:275381
leucine-rich repeat 190..213 CDD:275381
ARM 535..628 CDD:237987
C06C3.4NP_495996.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3665
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.