DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5180 and CG8281

DIOPT Version :9

Sequence 1:NP_001138087.1 Gene:CG5180 / 192508 FlyBaseID:FBgn0043457 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_648161.1 Gene:CG8281 / 38880 FlyBaseID:FBgn0035824 Length:348 Species:Drosophila melanogaster


Alignment Length:357 Identity:70/357 - (19%)
Similarity:125/357 - (35%) Gaps:115/357 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRHWLTEFIEQYQEEECLWQPKHNDYSNHTARNKSYDRLVEKLKEVEPNPDRAMVVRKINSLRSA 73
            :||:|..||:.|::...||.....||:|...|.::|.|||.....::.:.....|.:|||:||:.
  Fly    19 NRHYLRAFIQTYRDLPVLWDTSLRDYTNREKRAEAYLRLVPIYHYLKRDATVEDVKKKINTLRTN 83

  Fly    74 FRREFRKTST---KGD-YATRLWYYDKLLFIADHKPKRHELGSKPKRELHISFDDEESMEFEDDS 134
            :|:|.:...:   .|. ::.|.|.:.:|.|:.:         |:....::.:|.:|.:..|.:.|
  Fly    84 YRKELKVVESALRSGSLHSPRCWTFQELDFLRN---------SEKFLAVNPAFKNEPNFAFGESS 139

  Fly   135 HHTGTQSQHMESIIPTSPDDVEEVAATANNVVVSSQGATLSTISVTPAECVTLVKSEEHQAAEAA 199
            :                          ..:..:.||||.|                  |..|..|
  Fly   140 N--------------------------CPSAFLESQGAAL------------------HYPAPRA 160

  Fly   200 AAAAQAHQQMVAHAAAQTSIAAAAAQGHAVKVLEITSLDSNSQREIQQAVNHLEHHQQQLHLQQT 264
            .                         |....:.|:......:......|.||:::...:      
  Fly   161 G-------------------------GQTPNISEMFHKSFGAPPPPPPATNHVDYGSSK------ 194

  Fly   265 NGQHQGVPTIQIGRDHYQPLFGNAGTTAYTTTAATSTSHRQDD--------------EYDAIGVN 315
                         |....|....||..:.....||.|:|..|:              |.::|...
  Fly   195 -------------RARQTPPCTGAGAGSTGGPGATGTAHNTDELLNIACEYLAGTYPEEESIART 246

  Fly   316 VASKLRSINPTQRIVAEKLISDVLFNAQLGNL 347
            ...||:.:...||::||:.|:::||.|:..||
  Fly   247 WTHKLKRLPREQRLLAERFINEILFEAESNNL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5180NP_001138087.1 MADF_DNA_bdg 16..100 CDD:287510 25/87 (29%)
CG8281NP_648161.1 MADF_DNA_bdg 26..114 CDD:287510 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468897
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I7391
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6483
65.990

Return to query results.
Submit another query.