DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5180 and CG10904

DIOPT Version :9

Sequence 1:NP_001138087.1 Gene:CG5180 / 192508 FlyBaseID:FBgn0043457 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001286800.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster


Alignment Length:226 Identity:46/226 - (20%)
Similarity:85/226 - (37%) Gaps:62/226 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YSRHWLTEFIEQYQEEECLWQPKHNDYSNHTARNKSYDRLVEKLKEVEPNPDRAMVVRKINSLRS 72
            ::|..:.:.||.|:..:|||......|.|...|.|:.:.:...|:..:.:     ..:|:::||:
  Fly    24 WTREKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLEITKHD-----YGKKVHNLRN 83

  Fly    73 AFRREFRKTSTK-----GD----YATRLWYYDKLLF---IADHKP--KRHELGSKPKRELHISFD 123
            .|..|.:|...:     ||    .|.|..::..|:|   :.:.:|  ::...|.|...:|.:.:.
  Fly    84 QFNAELKKLERRLEESGGDRDSEKACRWEHFKTLMFLRSVIEPRPGYQQGAPGKKLVSKLDMCYP 148

  Fly   124 DE-------------ESMEFEDDSHHTGTQSQHMESIIPTSPDDVEEVAATANNVVVSSQGATLS 175
            |:             |||..|:|:..  .|...:...||..|.:                     
  Fly   149 DQDVEKQSQSSIESLESMIIENDAEI--CQPPKVSEPIPPMPPE--------------------- 190

  Fly   176 TISVTPAECVTLVKSEEHQAAEAAAAAAQAH 206
                 ||.....|  :.::..||.||.:..|
  Fly   191 -----PAPSSKFV--DPNRTVEAPAAPSPFH 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5180NP_001138087.1 MADF_DNA_bdg 16..100 CDD:287510 23/95 (24%)
CG10904NP_001286800.1 MADF 31..125 CDD:214738 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.