DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5180 and CG33017

DIOPT Version :9

Sequence 1:NP_001138087.1 Gene:CG5180 / 192508 FlyBaseID:FBgn0043457 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001286483.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster


Alignment Length:344 Identity:62/344 - (18%)
Similarity:122/344 - (35%) Gaps:80/344 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EFIEQYQEEECLWQPKHNDYSNHTARNKSYDRLVEKLKEVEPNPDRAMVVRKINSLRSAFRRE-- 77
            :.|..|:..||||.||...:.:.:|::.::.::..:: .....||:  |..::..||..:.:|  
  Fly    20 KLIRLYRSNECLWNPKSPGFHSGSAKDDAWRQITRRM-NCGLTPDQ--VELQVLGLRHYYSKELA 81

  Fly    78 -FRKTSTKG-DYATRLWYYDKLLFIADHKPKRHELGSKPKRELHI--SFDDE---ESMEFEDDS- 134
             .|.:..:| .|:.|..|::.|.|:.:    ..|..:.|.:|.|.  :|.::   ..:.|...| 
  Fly    82 AIRNSQIEGYSYSPRYSYFEDLHFLGN----LEEEANCPIKEGHFPPNFSEDTFISPLAFLSPSC 142

  Fly   135 HHTGTQSQHMESIIPTSPDDVEEVAATANNVVVSSQGATLSTISVTPAECVTLVKSEEHQAAEAA 199
            ..|.......:.|:...|.: ||.....:....|.......|     |.||.....|:....||.
  Fly   143 SETRCGYTFYKMILEPEPPN-EEFLGVHHERSTSGNDRWYPT-----AYCVRCKPEEDEDPCEAC 201

  Fly   200 AAAAQAHQQMVAHAAAQTSIAAAAAQGHAVKVLEITSLDSNSQREIQQAVNHLEHHQQQLHLQQT 264
            ....|:.:...   .:::|:....:.....::       ||..:|..|:    ...|:....|..
  Fly   202 ELRGQSSRPQF---GSKSSLEGGESGSTNPRM-------SNRYQEQDQS----NKFQKSDSKQYR 252

  Fly   265 NGQHQGVPT---------------IQIGRDHYQPLFGNAGTTAYTTTAATSTSHRQDDEYDAIGV 314
            .|:....||               :.:|.|::                         |.|:::|.
  Fly   253 TGKPCSCPTKDNPEKRSSQTQQNDVYVGADNW-------------------------DGYESVGN 292

  Fly   315 NVASKLRSINPTQRIVAEK 333
            .:.|...   |..|:.::|
  Fly   293 GIRSDRW---PGPRLCSQK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5180NP_001138087.1 MADF_DNA_bdg 16..100 CDD:287510 21/87 (24%)
CG33017NP_001286483.1 MADF_DNA_bdg 21..106 CDD:287510 21/87 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468906
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.