DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5180 and CG15601

DIOPT Version :9

Sequence 1:NP_001138087.1 Gene:CG5180 / 192508 FlyBaseID:FBgn0043457 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster


Alignment Length:358 Identity:72/358 - (20%)
Similarity:117/358 - (32%) Gaps:132/358 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTEFIEQYQEEECLWQPKHNDYSNHTARNKSYDRLVEKLKEVEPNPDRAMVVRKINSLRSAFRRE 77
            :|||:|.|:.:.||:....:.|.|..:|.::|..::..||  .|....:.:..||.|:|:.:.:|
  Fly    11 ITEFLEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIRSLK--IPQLTVSDIKLKIKSVRTVYSKE 73

  Fly    78 FRKTSTKGDYATRLWYYDKLLFIADHKPKRHELGS--KPK-----------RELHISFDDEESME 129
            .           |:|..:|            |||.  :||           |.:.:|....:...
  Fly    74 L-----------RIWMREK------------ELGRTYEPKLFWFRLADSFLRSVSLSHCKRQGKN 115

  Fly   130 FEDDSHHTGTQSQHMESIIPT-------SPDDVEEVAATAN----NVVVSSQGATLSTISVTPAE 183
            ....:..|..:|.....::.|       |.|.:||..|..|    ...:.....|.|........
  Fly   116 NSSSAQLTTIKSDETSKLLCTAAADITMSEDALEEEDAEVNGEPEECPLEESRPTASICKDDSTL 180

  Fly   184 CVTLVKSEEHQAAEAAAAAAQAHQQMVAHAAAQTSIAAAAAQGHAVKVLEITSLDSNSQREIQQA 248
            |:.....:||.:...:::      |.:.|..||.            |...||||||         
  Fly   181 CLADQPQQEHYSQGCSSS------QQLPHTMAQR------------KSKYITSLDS--------- 218

  Fly   249 VNHLEHHQQQLHLQQTNGQHQGVPTIQIGRDHYQPLFGNAGTTAYTTTAATSTSHRQDDEYDAIG 313
                                                   ||                :|:....|
  Fly   219 ---------------------------------------AG----------------EDDLIIFG 228

  Fly   314 VNVASKLRSI-NPTQRIVAEKLISDVLFNAQLG 345
            .::||:||:| :...|.||:..|..|||.|:.|
  Fly   229 QSIASQLRTIPDSYSRSVAKLRIQQVLFEAETG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5180NP_001138087.1 MADF_DNA_bdg 16..100 CDD:287510 20/83 (24%)
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:287510 25/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.