DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndf and psip1a

DIOPT Version :9

Sequence 1:NP_001188767.1 Gene:Ndf / 192507 FlyBaseID:FBgn0043456 Length:603 Species:Drosophila melanogaster
Sequence 2:XP_009289823.1 Gene:psip1a / 553760 ZFINID:ZDB-GENE-050522-104 Length:417 Species:Danio rerio


Alignment Length:441 Identity:102/441 - (23%)
Similarity:170/441 - (38%) Gaps:87/441 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YKPKDLIWAKMKGFTPWPGMIVDPPLDLLSQQRRANTKC-VFFFGSRNFAWIEENNIKPFEGPWK 83
            :|..|||:|||||:..||..|.:.|...:   :.:|.|. :||||:...|::...:|.|:... |
Zfish     5 FKAGDLIFAKMKGYPHWPARIDEIPDGAV---KPSNIKFPIFFFGTHETAFLGPKDIFPYLTN-K 65

  Fly    84 EELAKVSKPAAFRHAMTDIEKYIDDPAEVDEQVNKSCGAPNHATEADFDKIRDGLDSEEIVGEEA 148
            ::..|.:|...|...:.:||.  :...|::....|..|..:         |:|...:||...|:.
Zfish    66 DKYGKPNKRKGFNEGLWEIEN--NPKVELNGHKVKKVGEVS---------IKDLSSNEEGDDEKR 119

  Fly   149 TADGNNGVVAHVVGSPDE-----GDGLDVEIN-----ADSSASPVTSPAVTTKAAGKRTPKAKSV 203
            |   .:..:||..|..||     .||.|::::     .|...|...|..||.||  ||..|.||.
Zfish   120 T---KSAQIAHSEGLEDEVDIEKEDGGDMDVSDQRLVKDEDLSQKDSTNVTAKA--KRGRKRKSD 179

  Fly   204 A-----------------------ATSVKSTKGSAKSAQKRRT---SAQQSPSGPSNAKRGKRDV 242
            |                       .||:...|...:.::..::   ..|.|...|.:.|.||||.
Zfish   180 AEQDSDTENSSPTAGGSGLDFLSTGTSIMLLKRRGRKSKTEKSIILQQQASKELPRSGKDGKRDE 244

  Fly   243 -SGEALQDADEASSTPTGRRRVETDALLASIAAKRAPNAIALLDRPVVTRPEAQ----------V 296
             .|:..::....|:.......::|...:.::..::..:|:..|....||....|          .
Zfish   245 RKGDKRKEVSAESTLQKLHGEIKTSLKIGNLDVRKCVHALDELSSLHVTTQHLQRHSELIATLKK 309

  Fly   297 IDMSSRSNTLADRDIVPSEQTFGFLGLGMMGSTIVKDLIYTGHKVV--VWNRTIDKCQPFAEAGA 359
            |.....|..:.|:.|:...:   |..:.:||.         |..|:  |.|:::.:.:.|.||..
Zfish   310 ICRFKSSQDVMDKAIMLYNK---FKSMFLMGE---------GESVLSQVLNKSLTEQKLFEEAKR 362

  Fly   360 EVKDTPMDVVEAADV-----IFCCVSDPKGAKDLVFGNCGVLQLKDLNNKA 405
            .|........|..|.     .|....|.:..||.:.||...:...::.|.|
Zfish   363 GVLKNTEQTKEQKDTKILNEDFNSEEDAETEKDKLGGNILSMVKNNMTNPA 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NdfNP_001188767.1 N_Pac_NP60 20..106 CDD:99897 28/86 (33%)
NAD_binding_2 316..477 CDD:281445 21/97 (22%)
MmsB 319..597 CDD:224995 21/94 (22%)
NAD_binding_11 481..597 CDD:291499
psip1aXP_009289823.1 HDGF_related 3..87 CDD:99895 28/87 (32%)
FRQ <104..195 CDD:286504 27/104 (26%)
LEDGF 256..357 CDD:288344 18/112 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.