DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndf and psip1b

DIOPT Version :9

Sequence 1:NP_001188767.1 Gene:Ndf / 192507 FlyBaseID:FBgn0043456 Length:603 Species:Drosophila melanogaster
Sequence 2:XP_021325735.1 Gene:psip1b / 407619 ZFINID:ZDB-GENE-030131-3273 Length:1564 Species:Danio rerio


Alignment Length:401 Identity:82/401 - (20%)
Similarity:153/401 - (38%) Gaps:107/401 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKLSLSGGDTTEKFIYKPKDLIWAKMKGFTPWPGMIVDPPLDLLSQQRRANTKCVFFFGSRNFAW 69
            |.:.:....||:.|  .|.|:::|||||:..||..|.:       .:...|...:||:|:.:..:
Zfish     3 KGVKMKSDQTTDDF--TPGDVVFAKMKGYPFWPARIAE-------GKAPKNKIPIFFYGTHSTTF 58

  Fly    70 IEENNIKPFEGPWKEELAKVSKPAAFRHAMTDIEKYIDDPAEVDEQVNKSCGAPNHATEADF--- 131
            :...:|..: .|.|::.|:.:|...|...|.:||   :||. |..:..|........:|:..   
Zfish    59 LFPKDIVHY-WPNKQKYAQANKRGGFEEGMWEIE---NDPG-VGLRGQKKAALVKRLSESRLKWK 118

  Fly   132 -DKIRDGLDSEEIVGEEATADGNNGVVAHVVGSPDEGDGLDVEINADSSASPVTSPAVTTKAAGK 195
             .|.:...:..|:.....:|.                   |...|:||.|:          ...|
Zfish   119 NKKKKKAENQTEVKKPPKSAK-------------------DPVSNSDSKAA----------TPHK 154

  Fly   196 RTPKAKSVAATSVKSTKGSAKSAQKRRTSAQQSPSGPSNAKRGKRDVSGEALQDADEASSTPTGR 260
            |..|::||.....|:|:  .:..:.|.:||:.|    ::.:|..:.|....:   ....:..||.
Zfish   155 RETKSESVTLKDDKNTE--TRPTRSRDSSAKTS----TDKRRTDKVVPARKM---TSVKTITTGW 210

  Fly   261 RRVETDALLA-------SIAAKRAPNAIALLDRPVVTRPEAQVIDMSSRSNTLADRDIV-PSEQT 317
            ||:.:..:||       :::|.|.    .:|:|.:::..:.::..::.|..:...|... |.|.|
Zfish   211 RRLPSSVILARRMDAAKTLSAHRK----HVLNRKIISTAKKRIDAVNHRKPSRITRSTADPIEAT 271

  Fly   318 FGFLGLGMMGSTIVKDLIYTGHKVVVWNRTIDKCQPFA------EAGAEVK-DTPMDVVEAADVI 375
                          .|:               ..:|.|      :..:||| |.|:. :.|.|: 
Zfish   272 --------------DDV---------------TAKPLALKRKRKQNDSEVKGDAPIS-IPATDI- 305

  Fly   376 FCCVSDPKGAK 386
             ...|.|.|:|
Zfish   306 -SASSTPTGSK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NdfNP_001188767.1 N_Pac_NP60 20..106 CDD:99897 23/85 (27%)
NAD_binding_2 316..477 CDD:281445 15/78 (19%)
MmsB 319..597 CDD:224995 14/75 (19%)
NAD_binding_11 481..597 CDD:291499
psip1bXP_021325735.1 HDGF_related 14..93 CDD:99895 24/91 (26%)
Neuromodulin_N <221..921 CDD:331332 23/131 (18%)
Neuromodulin_N <586..1321 CDD:331332
LEDGF 1440..1534 CDD:314400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.