DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndf and Hdgfl2

DIOPT Version :9

Sequence 1:NP_001188767.1 Gene:Ndf / 192507 FlyBaseID:FBgn0043456 Length:603 Species:Drosophila melanogaster
Sequence 2:XP_006244351.1 Gene:Hdgfl2 / 171073 RGDID:621013 Length:678 Species:Rattus norvegicus


Alignment Length:313 Identity:80/313 - (25%)
Similarity:129/313 - (41%) Gaps:59/313 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YKPKDLIWAKMKGFTPWPGMI-------VDPPLDLLSQQRRANTKCVFFFGSRNFAWIEENNIKP 77
            :||.||::|||||:..||..|       |.||         .|...:||||:...|::...::.|
  Rat     5 FKPGDLVFAKMKGYPHWPARIDDIADGAVKPP---------PNKYPIFFFGTHETAFLGPKDLFP 60

  Fly    78 FEGPWKEELAKVSKPAAFRHAMTDIEKYIDDPAEVDEQVNKSCGAP-------NHATEADFDKIR 135
            :: ..|::..|.:|...|...:.:|:   ::|       :.|..||       :.|.|||.....
  Rat    61 YD-KCKDKYGKPNKRKGFNEGLWEIQ---NNP-------HASYSAPLPVSSSDSEAPEADLGGGS 114

  Fly   136 DGLDSEEIVGEEATADGNNGVVAHVVGSPDEGDGLDVEINADSSASPVTSPAVTTKAAGKRTPKA 200
            |. |.|:......|.   ..|.........|.|. |.:.|:|.|.....:| |...:..||..||
  Rat   115 DA-DKEKEARRVMTV---TAVTTTATSGRTESDS-DSDKNSDHSGLKRKTP-VLKMSVSKRARKA 173

  Fly   201 KS-VAATSVK-STKGSAKSAQKRRTSAQQ-SPSGPSNAKRGKRDVSGEALQDADEASSTPTGRRR 262
            .| :...||. |.:.|...::..:||.|. :|...:.|:..:|...|...:.....|:.|   ::
  Rat   174 SSDLDQASVSPSEEDSESPSESEKTSDQDFTPEKKTIARAPRRAPLGGRKKKQPTGSACP---QK 235

  Fly   263 V----ETDALLASIAAKRAPNAIALLDRPVVTRPEAQVIDMSSRSNTLADRDI 311
            |    ::|:...|..||         :.||||...:.....||.|::.:|.|:
  Rat   236 VPSASDSDSRADSDGAK---------EEPVVTAQPSPSSSSSSSSSSASDSDV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NdfNP_001188767.1 N_Pac_NP60 20..106 CDD:99897 27/92 (29%)
NAD_binding_2 316..477 CDD:281445
MmsB 319..597 CDD:224995
NAD_binding_11 481..597 CDD:291499
Hdgfl2XP_006244351.1 HDGF_related 3..87 CDD:99895 27/94 (29%)
LEDGF 477..561 CDD:288344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.