DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndf and HIBADH

DIOPT Version :9

Sequence 1:NP_001188767.1 Gene:Ndf / 192507 FlyBaseID:FBgn0043456 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_689953.1 Gene:HIBADH / 11112 HGNCID:4907 Length:336 Species:Homo sapiens


Alignment Length:354 Identity:88/354 - (24%)
Similarity:154/354 - (43%) Gaps:50/354 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 LLASIAAKRAPNAIALLDRPVVTRPEA-QVIDMSSRSNTLADRDIVPSEQTFGFLGLGMMGSTIV 331
            :.||:....|.:.:....|.:  ||.| ....:.|||        |.|:...||:|||.||:.:.
Human     1 MAASLRLLGAASGLRYWSRRL--RPAAGSFAAVCSRS--------VASKTPVGFIGLGNMGNPMA 55

  Fly   332 KDLIYTGHKVVVWNRTIDKCQPFAEAGAEVKDTPMDVVEAADVIFCCVSDPKGAKDLVFGNCGVL 396
            |:|:..|:.:::::...|.|:.|.:||.:|..:|.||.|.||.|...:.....|.:...|..|:|
Human    56 KNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGIL 120

  Fly   397 QLKDLNNKAYVEMSTIDPDTSLDIGEGIKQCNGRYLEAQIHGSRQEAAEGMLIILAGGDRSVFEE 461
            : |.......::.|||||..|.::.:.:::....:::|.:.|....|..|.|..:.||....|..
Human   121 K-KVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAA 184

  Fly   462 CHSCFKTIAKNTFFLGTDIGNACKVNLILQTILGVSLVGLAEALALADRFSISLNDIIDIFDLTS 526
            .......:..|..:.|. :|......:....:|.:|::|.|||:.|..|..:             
Human   185 AQELLGCMGSNVVYCGA-VGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGL------------- 235

  Fly   527 MKSPMLLAKGKEMAKG------DFNPQQ------PLSH----------MQRDLRLVLNMAENLDQ 569
              .|.||||...|:.|      .:||..      |.::          |.:||.|..:.|.:...
Human   236 --DPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKS 298

  Fly   570 SMPVTSITNEVFKHTKRLGYSEHDSSAVF 598
            .:.:.|:.:::::.....|||:.|.|:||
Human   299 PILLGSLAHQIYRMMCAKGYSKKDFSSVF 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NdfNP_001188767.1 N_Pac_NP60 20..106 CDD:99897
NAD_binding_2 316..477 CDD:281445 43/160 (27%)
MmsB 319..597 CDD:224995 74/299 (25%)
NAD_binding_11 481..597 CDD:291499 30/137 (22%)
HIBADHNP_689953.1 HIBADH 44..331 CDD:130753 75/301 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.