DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndf and Psip1

DIOPT Version :9

Sequence 1:NP_001188767.1 Gene:Ndf / 192507 FlyBaseID:FBgn0043456 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_598709.1 Gene:Psip1 / 101739 MGIID:2142116 Length:528 Species:Mus musculus


Alignment Length:274 Identity:66/274 - (24%)
Similarity:108/274 - (39%) Gaps:48/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YKPKDLIWAKMKGFTPWPGMI-------VDPPLDLLSQQRRANTKCVFFFGSRNFAWIEENNIKP 77
            :||.|||:|||||:..||..:       |.||.:.|.         :||||:...|::...:|.|
Mouse     5 FKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLP---------IFFFGTHETAFLGPKDIFP 60

  Fly    78 FEGPWKEELAKVSKPAAFRHAMTDIE-----KYIDDPAEVDEQVNKSCGAPNHATEADFDKIRDG 137
            :... ||:..|.:|...|...:.:|:     |:....|.. :|.|.|........|.:..|  :.
Mouse    61 YSEN-KEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAST-KQSNASSDVEVEEKETNVSK--ED 121

  Fly   138 LDSEEIVGEEATADGNNGVVAHVVGSPDEGDGLDVEINADSSASPVTSPAVTTKAAGKRTPKAKS 202
            .|.||....|   |....|......:...|.....|...|:..:.:.:.|..:..  |.:||...
Mouse   122 TDQEEKASNE---DVTKAVDITTPKAARRGRKRKAEKQVDTEEAGMVTAATASNV--KASPKRGR 181

  Fly   203 VAATSVKSTK--GSAKSAQK-----------RRTSAQQSPSGPSNAKRGKRDVSGEALQDADEAS 254
            .|||.||..|  |..|..::           ...|.::.|......|:.|::..|:  ::.::..
Mouse   182 PAATEVKIPKPRGRPKVVKQPCPSDGDMVIDEDKSKKKGPEEKQPKKQLKKEEEGQ--KEEEKPR 244

  Fly   255 STP---TGRRRVET 265
            ..|   .|::.||:
Mouse   245 KEPDKKEGKKEVES 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NdfNP_001188767.1 N_Pac_NP60 20..106 CDD:99897 30/97 (31%)
NAD_binding_2 316..477 CDD:281445
MmsB 319..597 CDD:224995
NAD_binding_11 481..597 CDD:291499
Psip1NP_598709.1 HDGF_related 3..87 CDD:99895 29/91 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..348 43/209 (21%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:O75475 146..156 2/9 (22%)
Integrase-binding domain (IBD). /evidence=ECO:0000250|UniProtKB:O75475 338..415
LEDGF 347..448 CDD:288344
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..528
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.