DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5986 and AT4G01000

DIOPT Version :10

Sequence 1:NP_651207.1 Gene:CG5986 / 192506 FlyBaseID:FBgn0043455 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_192009.1 Gene:AT4G01000 / 826414 AraportID:AT4G01000 Length:415 Species:Arabidopsis thaliana


Alignment Length:227 Identity:73/227 - (32%)
Similarity:115/227 - (50%) Gaps:39/227 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ISCGDHVKCDELYSRIAEKTNLQPGEYYLVSNGKRLE--GEISSGD--VHCVLRQLGGKGGFGSM 73
            ::.|:.:|     .||.|:|.:......|:|.|.::.  ..||..|  |:.||...||||||||:
plant    29 LAYGEQIK-----QRIFEQTKIPTHLQRLISGGYQISDGSAISQPDATVNLVLSLRGGKGGFGSL 88

  Fly    74 LRAIG--AQIEKTTNREACRDLSGRRLRDINEEKRVRAWLEKQGEREREAEERKKRKIEKLLAVP 136
            ||..|  |..:||.|.:||||:||||||.:|.|.|::.|  |.||..|..|::....::|     
plant    89 LRGGGMKAGQKKTNNFDACRDMSGRRLRHVNAENRLQEW--KDGEEGRNLEKKALEYLKK----- 146

  Fly   137 KHDFKDDKYEEARAN-LTEKVNDAFEEGLKQAEENK-----EKGVEEATSSGTKRKSPAVDKTKA 195
                :.:|.::...| .|:|..:.::|     |.:|     :..:.|:..:|.::.....:..|.
plant   147 ----QSNKVKQGVGNGATQKYVNKYKE-----ESDKCILAVDLALNESFKNGKRKAKIGAESEKK 202

  Fly   196 KKKK--KGTLWIDDDISGSDSDSDDSEEEPKT 225
            |:.|  ||...::|    ||||..|.||:.|:
plant   203 KRLKIWKGKRAVED----SDSDDSDDEEDEKS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5986NP_651207.1 Ubl1_cv_Nsp3_N-like <58..113 CDD:475130 31/56 (55%)
AT4G01000NP_192009.1 Ubl1_cv_Nsp3_N-like 10..156 CDD:475130 51/142 (36%)
SDE2_2C 351..402 CDD:463835
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.