DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5986 and AT3G06455

DIOPT Version :10

Sequence 1:NP_651207.1 Gene:CG5986 / 192506 FlyBaseID:FBgn0043455 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_850523.2 Gene:AT3G06455 / 819822 AraportID:AT3G06455 Length:345 Species:Arabidopsis thaliana


Alignment Length:228 Identity:55/228 - (24%)
Similarity:81/228 - (35%) Gaps:93/228 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ISCGDHVKCDELYSRIAEKTNLQPGEYYLVSNGKRLEG--EISSGD--VHCVLRQLGGKGGFGSM 73
            |:||:.:|     .||.|:|.:......|:|.|.::.|  .||..|  ::.||...|||||.||:
plant    29 IACGEQIK-----QRIFEQTKIPTHLQRLISGGFQIPGASAISQSDTTMNLVLSLRGGKGGLGSL 88

  Fly    74 LR--AIGAQIEKTTNREACRDLSGRRLRDINEEKRVRAWLEKQGEREREAEERKKRKIEKLLAVP 136
            ||  .:.|..:||.|.::|                                              
plant    89 LRNVVMKAGQKKTNNFDSC---------------------------------------------- 107

  Fly   137 KHDFKDDKYEEARANLTEKVNDAFEEGLKQAEENKEKG------------VEEATSSGTKRKSPA 189
                               |.|    |..|...||.||            :.|...:|.|||...
plant   108 -------------------VGD----GATQKNVNKYKGGSDKCILAVHLALNETFKNGNKRKGKK 149

  Fly   190 VDKTKAKKKKKGTLWIDDDISGSDSDSDDSEEE 222
            :...:::|.|:..:| :...:..|||||||.:|
plant   150 MGTAESEKSKRIKIW-NGKRAVEDSDSDDSSDE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5986NP_651207.1 Ubl1_cv_Nsp3_N-like <58..113 CDD:475130 16/56 (29%)
AT3G06455NP_850523.2 Ubl1_cv_Nsp3_N-like 10..75 CDD:475130 15/50 (30%)
SDE2_2C 281..332 CDD:463835
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.