DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59c and Gr66a

DIOPT Version :9

Sequence 1:NP_726292.1 Gene:Gr59c / 192481 FlyBaseID:FBgn0041235 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster


Alignment Length:184 Identity:38/184 - (20%)
Similarity:72/184 - (39%) Gaps:45/184 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 CSLADQLDLIAERHYFLKDRLDEMSDLFQIQSLSMSLVYFFSTMGSIYFSVCSILYSSTGFGSTY 290
            |.:.|::..|.:          .:::|:....||:....|......:||..|:..|.|  ..|.:
  Fly   325 CQVHDEICEIGK----------ALNELWSYPILSLMAYGFLIFTAQLYFLYCATQYQS--IPSLF 377

  Fly   291 WG-----LLLIVLSTAS------FYMDNWLS------VNIGFHIRDQQDELFRVLADRTLFYREL 338
            ..     :.:||||..|      .|: :|.:      ..|..|       ...|:||..|.| |:
  Fly   378 RSAKNPFITVIVLSYTSGKCVYLIYL-SWKTSQASKRTGISLH-------KCGVVADDNLLY-EI 433

  Fly   339 DNRLEAAFENFQLQLASNRHEFYVMGLFKMERGRLIAMLSSVITHTMVLVQWEI 392
            .|.|       .|:|.::..:|...|.|.::...|..:...:.::.::|:|:.:
  Fly   434 VNHL-------SLKLLNHSVDFSACGFFTLDMETLYGVSGGITSYLIILIQFNL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59cNP_726292.1 7tm_7 9..394 CDD:285581 38/184 (21%)
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 37/180 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.