DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpn12 and CG42327

DIOPT Version :9

Sequence 1:NP_001343519.1 Gene:Ptpn12 / 19248 MGIID:104673 Length:789 Species:Mus musculus
Sequence 2:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster


Alignment Length:296 Identity:86/296 - (29%)
Similarity:138/296 - (46%) Gaps:66/296 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    75 KNRYKDILPFDHSRVKLTLKTPSQDSDYINANFIKGVY-GPKAYVATQGPLANTVIDFWRMIWEY 138
            ||||.:::|...:||.|..:.....::|||||:::|.. .|..|:|.|.||.:|..||||||||.
  Fly  1135 KNRYANVIPLPETRVVLQRQGDDDKTEYINANYVRGPRDAPNYYIACQAPLESTTSDFWRMIWEQ 1199

Mouse   139 NVVIIVMACREFEMGRKKCERYWPLYG--EDPITFAPFKISCENEQARTDYFIRTLLLEFQN--E 199
            ...:|:.|....|.|.::|..|.|...  ::..::..::::.::.:.:..|.|.||:|:..:  |
  Fly  1200 QSRVIIQATDLSENGIERCAEYLPPSATLDNHSSYGDYQVTLKHREVKDRYAISTLVLKRVDGEE 1264

Mouse   200 SRRLYQFHYVNWPDHDVPSSFDSILDMI----SLMRKY--------------------------- 233
            ||.|..:.| .||:..||:....|:.|:    |.::.|                           
  Fly  1265 SRELTHYWY-KWPEAGVPAEEAPIIAMLLEARSSLKSYSLEQANELREKSATLETSMDADGSKAE 1328

Mouse   234 ----QEHE--------------DVPICIHCSAGCGRTGAICAIDYTWNLLKAGK----IPEEFNV 276
                ..||              ..|:.:|||.|.||||.|.|.|.....|:..|    ||:    
  Fly  1329 AGSTSSHEINGNISSRSGTRSQQGPLTVHCSPGTGRTGTIIASDMAIRSLETPKRSVDIPQ---- 1389

Mouse   277 FNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQL 312
              |:..:|..|.||||||||||.::: :|.::..::
  Fly  1390 --LVYYVRRGRASAVQTKEQYEFIYK-VASMYAAKI 1422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpn12NP_001343519.1 PTP_DSP_cys 43..312 CDD:391942 86/294 (29%)
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 85/287 (30%)
Y_phosphatase 1134..1415 CDD:278528 85/287 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.