DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpn12 and PTP-ER

DIOPT Version :9

Sequence 1:NP_001343519.1 Gene:Ptpn12 / 19248 MGIID:104673 Length:789 Species:Mus musculus
Sequence 2:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster


Alignment Length:458 Identity:110/458 - (24%)
Similarity:157/458 - (34%) Gaps:219/458 - (47%)


- Green bases have known domain annotations that are detailed below.


Mouse    75 KNRYKDILPFDHSRVKLTLK-----------------TPSQDSDYINANFIKGV-YGPKAYVATQ 121
            |||||.|||.::|||.|..:                 |.|:|..|||||:|||. |..|.|||||
  Fly   918 KNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCYVATQ 982

Mouse   122 GPLANTVIDFWRMIWEYN---------------------------VVIIVMACREFEMGRKKCER 159
            |||.||:.:||.||::..                           ...|||.....|..|:||..
  Fly   983 GPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAV 1047

Mouse   160 YWPL-----------------------YGEDPI--TFAP-----------------------FKI 176
            |:|:                       |.:..:  ||.|                       .|:
  Fly  1048 YFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKV 1112

Mouse   177 SCENE-------------------QARTDYFIRTLLLEF-----QNES---RRLYQFH--YVNWP 212
            :.|.:                   ..|..|.:|.|:|.:     |:.|   :::|.:|  |.:||
  Fly  1113 TLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWP 1177

Mouse   213 DHDVPSSFDSILD----MISL-------------------------MRKYQEH-----EDVPICI 243
            ||..|...:::||    :::|                         :..||:.     :.:|: |
  Fly  1178 DHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPV-I 1241

Mouse   244 HCSAGCGRTGAICAI---------------------------------------DYTWNLLK--- 266
            |||||.||||...||                                       .:|.|.::   
  Fly  1242 HCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRHIS 1306

Mouse   267 ---------AGKIPEEF-----------NVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQ 311
                     |.|.|..|           :|..::..:|.||...||..|||||:||||....::.
  Fly  1307 HILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAICLYLKRT 1371

Mouse   312 LQL 314
            |.|
  Fly  1372 LAL 1374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpn12NP_001343519.1 PTP_DSP_cys 43..312 CDD:391942 108/454 (24%)
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 106/446 (24%)
PTPc 917..1364 CDD:238006 106/446 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.