DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptgs1 and cysu

DIOPT Version :9

Sequence 1:NP_032995.1 Gene:Ptgs1 / 19224 MGIID:97797 Length:602 Species:Mus musculus
Sequence 2:NP_650627.1 Gene:cysu / 42100 FlyBaseID:FBgn0038511 Length:753 Species:Drosophila melanogaster


Alignment Length:346 Identity:72/346 - (20%)
Similarity:130/346 - (37%) Gaps:87/346 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   300 LMLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQHLSGYFLQLKF- 363
            |....|:..|||||:...|.:.:..||||.|||..|.|.|.....:...|::..|.|..:..|| 
  Fly   388 LTCMHTLMAREHNRLATALAQINKHWDDETLFQEARRINIAIVQHVTFNEFLPILLGKEVMEKFG 452

Mouse   364 ----------------DPELL---FRAQFQYRNRIAMEFNHLYHWHPLMPNSFQVGSQEYSY--- 406
                            :|.::   ..|.|::             .|.|:|.:.:..|:.:.:   
  Fly   453 LVLQKDGYWDGYDSTVNPGIIDSFAGAAFRF-------------GHSLLPTAVERWSKAHKFIAS 504

Mouse   407 ---------EQFLFNTSMLVDYGV-------EALVDAFSRQRAGRIGGGRNFDYHVLHVAVDVI- 454
                     ...|:...:|.:|.:       :|:.|:.:::....:     |........:|:: 
  Fly   505 KRLSDLIRRPYDLYRAGVLDEYFMGLMNQVAQAMDDSITQEVTNHL-----FKKEGARFGMDLVS 564

Mouse   455 ---KESREMRLQPFNEYRKRFGLKPYTSFQELTGEKEMAAELEELYGDI----DALEFYPGLLLE 512
               :..||..:..:.|:||..||....::.|:.|  .|..|....||.|    ..::.:.|.:.|
  Fly   565 FNMQRGREFGIPGYMEFRKFCGLPTSNTWDEMYG--SMPNETVLRYGSIFEHPADIDLWSGGVSE 627

Mouse   513 KCQPNSIFGES---MIEMGAPFSLKGLLGNPICSPEYW-----KPSTFGGDVGFNLVNTASLKKL 569
            |..|.|:.|.:   :|.....:..:|        ..:|     :||:|..: ....:..|.|.:|
  Fly   628 KSLPGSMLGPTFACVIATQMSYLRRG--------DRFWYELPNQPSSFTPE-QLQEIRKAKLSRL 683

Mouse   570 VCLNT---KTCPYVSFRVPDY 587
            :|.||   .|.......:||:
  Fly   684 ICDNTDLIDTVQIYPMVLPDH 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptgs1NP_032995.1 EGF_CA 35..72 CDD:238011
prostaglandin_endoperoxide_synthase 92..578 CDD:188648 70/335 (21%)
cysuNP_650627.1 An_peroxidase 155..692 CDD:281139 69/332 (21%)
peroxinectin_like 305..687 CDD:188655 67/327 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.