DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptgs1 and Irc

DIOPT Version :9

Sequence 1:NP_032995.1 Gene:Ptgs1 / 19224 MGIID:97797 Length:602 Species:Mus musculus
Sequence 2:NP_001262653.1 Gene:Irc / 42049 FlyBaseID:FBgn0038465 Length:697 Species:Drosophila melanogaster


Alignment Length:419 Identity:86/419 - (20%)
Similarity:154/419 - (36%) Gaps:96/419 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse   230 VDLGHIYGDNLERQYHLRLFKDGKLKYQ---VLDGEVYP--PSVEQASVLMRYPPGVPPERQMAV 289
            :||..:||.....:..||:.:.|.|:..   ..|..:.|  ...|..|...|...|  .....|.
  Fly   300 LDLSQLYGFTAAAERKLRVLEGGLLRSTPRGEFDNALLPIATDTEGPSFCARATIG--DGTCFAA 362

Mouse   290 GQEVFGLLPGLMLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQHL 354
            |.......|..:|..||::|.||:|...||:.:|.|.||:|||..:.:.:....::||||::..:
  Fly   363 GDSRVNSSPFSILIYTIFMRNHNKVAAELKQRNPRWSDEKLFQAAKAVNVDIYRRVVIEEWLPEV 427

Mouse   355 SGYFLQLKFDPELLFRAQFQYRNRIAMEFNHLYHWHPLMPNS----------------------- 396
            .|..:..:...:...|| .:..|..|:.....|  ..::||.                       
  Fly   428 LGQKMSSEIRRKQPNRA-LEVSNEFAVAAIRFY--FSMLPNELLNLTKDNVVYGTEKNNQYVFIS 489

Mouse   397 --------FQVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQRAGRIGGGRNFDYHVLHVAVDV 453
                    |::  :|..|:..|..||..::..:|:|::..:.:......||..:.........|:
  Fly   490 KELPTKNLFEL--KEEIYKPKLQYTSQKLNNILESLLNQETMKMDAAYSGGVVWHKDTKPTHADI 552

Mouse   454 ----IKESREMRLQPFNEYRKRFGL-KPYTSFQELTG--EKEMAAELEELY---GDIDALEFYPG 508
                |:..|:..|.|:..|.:...| :|..|:::...  ..::..:|:.:|   .|:|       
  Fly   553 LAFDIQRGRDHGLLPYYRYLESCVLSRPVESWKDFEHFIPSDVLDKLKTIYASWADVD------- 610

Mouse   509 LLLEKCQPNSIFGESMIEMGAPFSL---------------KGLLGNPICSPEYWKPSTFGGDVGF 558
            |::.....|.:.|    .:|..||.               |.:..:.....:|   ..|.|    
  Fly   611 LIVGGISENPVHG----SIGPTFSCIISEQFVHVLKQNQQKAVQKHTELVEQY---RHFNG---- 664

Mouse   559 NLVNTASLKKLVCLNT--KTCPYVSFRVP 585
                    .||:|||:  ...|...|::|
  Fly   665 --------TKLLCLNSGLSAVPQNIFQLP 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptgs1NP_032995.1 EGF_CA 35..72 CDD:238011
prostaglandin_endoperoxide_synthase 92..578 CDD:188648 83/410 (20%)
IrcNP_001262653.1 An_peroxidase 151..672 CDD:281139 82/404 (20%)
An_peroxidase_like 290..637 CDD:265428 74/354 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.