DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptger4 and CG7497

DIOPT Version :9

Sequence 1:NP_032991.1 Gene:Ptger4 / 19219 MGIID:104311 Length:513 Species:Mus musculus
Sequence 2:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster


Alignment Length:446 Identity:104/446 - (23%)
Similarity:176/446 - (39%) Gaps:117/446 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse    22 TTTIMSI--PGVNASFSSTPERL---NSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYT 81
            ||.::.:  |. |::..:.|:.|   .:.:.|..::.:.||.||.:|:.:|  :||:..:.:.||
  Fly     4 TTPVLDLLMPH-NSTTVAPPKALYANRNRLIIGVIIMVLGVFGNSLALFIL--ARKKLNKNSKYT 65

Mouse    82 LVCGLAVTD----LLG----TLL---VSPVTIATYMKGQWPGDQALCDYSTFILLFFGLSGLSII 135
            |:.....|:    |||    |||   :|...:.::::....|        ..:..|||||...|.
  Fly    66 LMLRCLATNNLVALLGMLTTTLLKMYLSKEVLQSFIRVDCVG--------LVVWRFFGLSSGCIA 122

Mouse   136 CAMSIERYLAINHAYFYSHYVDKRLAGLTLFAIYASNVLFCALPNMGLGR-------------SE 187
            ..|:.||::|:...:.|..::...|...::.:|....|:...||.:|.|.             ..
  Fly   123 AVMAAERWMALARPFIYHKHITYELIRKSINSILMIAVVITFLPFVGFGAYIDESNPDQLKCIRY 187

Mouse   188 RQYPGTWCFIDWTTNVTAYAAFSYMYAGFSSFLILATVLCNVLVCGALL-----------RMHRQ 241
            |..||.|       |.|    ::.::..|.:.|.:..|.||:.|...||           .||..
  Fly   188 RDAPGVW-------NKT----YAVLFMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHMHYD 241

Mouse   242 FMRR-----------TSLGTEQHHAAAAAAVASVACRGHAGASPALQRLSDFRRRRSFRRIA--- 292
            .:.|           :|.||..:....:....:    .|....||.|    :|...|....|   
  Fly   242 LVSRDKNSAISIDPESSSGTTLYQTQLSTGSGN----SHRSVQPARQ----YRHSVSVTMAATDS 298

Mouse   293 -GAEIQMVILLIATSLVVLICSIPLVVRVFI----NQLYQPN---VVKDISRNPDLQAIRIASVN 349
             ..||:...|:...|:..:||.:|.::.:.:    |::...|   ::.|:     |.|:...|  
  Fly   299 SPVEIKFAKLMAFLSISFVICWMPQMIAIPLAIAPNRVPASNKFFIIADV-----LTALHFTS-- 356

Mouse   350 PILDPWIYILLRKTVLSKAIEKIKCLFC--------RIGGSGRDSSAQHCSESRRT 397
               ||::|:|.|    ||:| ....|.|        |.||..|..|.|  |..|.|
  Fly   357 ---DPYVYVLSR----SKSI-NWSLLGCIKRWRSGWRPGGLRRSQSDQ--SRMRTT 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptger4NP_032991.1 7tm_4 54..>254 CDD:304433 58/245 (24%)
7tm_1 59..357 CDD:278431 78/354 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..403 6/15 (40%)
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 49/205 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835066
Domainoid 1 1.000 54 1.000 Domainoid score I11155
eggNOG 1 0.900 - - E33208_3BHKU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5355
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 1 1.000 - - FOG0000857
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108572
Panther 1 1.100 - - O PTHR11866
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.