DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stab1 and NimB2

DIOPT Version :9

Sequence 1:NP_619613.2 Gene:Stab1 / 192187 MGIID:2178742 Length:2571 Species:Mus musculus
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:471 Identity:103/471 - (21%)
Similarity:149/471 - (31%) Gaps:174/471 - (36%)


- Green bases have known domain annotations that are detailed below.


Mouse  1883 QMKTCSICGLEPPCPRGSREQGSPETCWRHYSKF---WTTPLHSISMRGAYWIPSSFWN-RNHMS 1943
            |.||..|...:||.........|.|:.||.|::.   |:|...|          :..|| :||:.
  Fly    24 QFKTAGIKTRQPPSGNLQLAGNSSESGWRSYNQSSYGWSTQNQS----------NYAWNQQNHVE 78

Mouse  1944 RGCHRNCVTTVWKPSCCP---GHY------------------------------GINCH------ 1969
            :|........|::|...|   |||                              |: |:      
  Fly    79 QGSAGFVRAEVFQPVTLPPLYGHYVQPVTPPAHRVQVLDETALFINKTRSAMASGV-CYKEVPTA 142

Mouse  1970 ------------------------ACPGGPRSP---------CSD---HGVCLDGIRGSGQCNCH 1998
                                    .|.|..|:|         |:|   :|:|    .....|.|.
  Fly   143 SLLRNSRDQFVGNGTTPDMSRIQVCCDGYERNPHIYRRCEPICADDCRNGIC----TAPNTCVCI 203

Mouse  1999 PGFAGTA---CELCAPGAFGPQCQACRCTQHGRCDEGLGGSGSCFCDEGWTGARCEVQLELQPVC 2060
            ||...||   |....|...|          :|.|||    ...|.|.||::     ::.|.:..|
  Fly   204 PGHVRTAEGKCISTCPLGCG----------NGVCDE----RNECKCREGYS-----LEPETRKYC 249

Mouse  2061 TPPCAPQAVCRLG-----NSCECSLGYE--GDGRVCTVADLCQKGHGGCSKHANCSQVGTVVTCT 2118
            .|.|.|.  |..|     |.|.|..||.  .||....|.|.|:.|......|.||:.....:...
  Fly   250 QPECKPG--CSFGRCVAPNKCACLDGYRLAADGSCEPVCDSCENGKCTAPGHCNCNAGYLKLQGR 312

Mouse  2119 CLPDYEGDGWSCRARDPCLDGHRGGCSEHADCLNTGPNTRRCECHVGYVGD--GLQCLEELEPPV 2181
            |.|       .|..  ||.:|.         |:  ||:.  |||..|:..|  ..:||.:.:.| 
  Fly   313 CEP-------ICSI--PCKNGR---------CI--GPDI--CECASGFEWDRKSAECLPKCDLP- 354

Mouse  2182 DRCLGGSSPCHTDALCTDLHFQEKQAGVFHIQATSGPYGLTFSEAKEACEGQGAVLASLPQLSAA 2246
              ||.|....:....|...:.:::     |.:....|:      ..:.|:..   ..|.|     
  Fly   355 --CLNGVCVGNNQCDCKTGYVRDE-----HQRNICQPH------CPQGCQNG---YCSAP----- 398

Mouse  2247 QQLGFHVCFVGWLANG 2262
               .|.:|..|::.:|
  Fly   399 ---NFCICRPGFIKSG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stab1NP_619613.2 Fasciclin 520..644 CDD:280607
EGF_3 915..946 CDD:289699
EGF_3 952..988 CDD:289699
Fasciclin 1000..1121 CDD:280607
EGF_3 1460..1496 CDD:289699
EGF_3 1502..1539 CDD:289699
EGF_3 1545..1582 CDD:289699
Fasciclin 1607..1711 CDD:280607
Fasciclin 1737..1867 CDD:280607
EGF_Lam <1992..2021 CDD:214543 9/31 (29%)
EGF_3 2095..2130 CDD:289699 7/34 (21%)
EGF_3 2136..2173 CDD:289699 10/38 (26%)
Link_Domain 2208..2300 CDD:295393 9/55 (16%)
FAS1 2367..2463 CDD:214719
NimB2NP_723857.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.