DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptf1a and HLH4C

DIOPT Version :9

Sequence 1:NP_061279.2 Gene:Ptf1a / 19213 MGIID:1328312 Length:324 Species:Mus musculus
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:199 Identity:56/199 - (28%)
Similarity:84/199 - (42%) Gaps:47/199 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse    32 SRDPLEDSDELLGDEQAEV---EFLSHQLHEYCYRDGACLLLQPAPSAAPHALAPPPLGDPGEPE 93
            ||..|.|.||::|.....:   ::.:....:...|..|.:..:.|...||    |||        
  Fly    19 SRYYLVDDDEMIGPNNPHLVNEDYAASTTLDIDKRFQARMACETAAQPAP----PPP-------- 71

Mouse    94 DNVSYCCDAGAPLAAFPYSPGSPPSCLAYPCAAVLSPGARLGGLNGAAAAAAARRRRRVRSEAEL 158
                               |...|.....|.|. |.|...:|         .:|..||.|..|.|
  Fly    72 -------------------PTPAPRRRTTPIAH-LDPSELVG---------LSREERRRRRRATL 107

Mouse   159 QQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLR 223
             :.|.|...|||.|:::.|.:|..||..:||||.:|:|||::.|:|||.||.:|:.:::.  |..
  Fly   108 -KYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLET--PXD 169

Mouse   224 GSGA 227
            .:||
  Fly   170 SAGA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptf1aNP_061279.2 HLH 162..217 CDD:238036 25/54 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..324
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 25/56 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.