DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psmb4 and Prosbeta7

DIOPT Version :9

Sequence 1:NP_032971.2 Gene:Psmb4 / 19172 MGIID:1098257 Length:264 Species:Mus musculus
Sequence 2:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster


Alignment Length:257 Identity:105/257 - (40%)
Similarity:156/257 - (60%) Gaps:6/257 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse    12 WAGGPAPGQFYRIPA--TPSGLMDPASAPCEGP--ITRTQNPMVTGTSVLGVKFDGGVVIAADML 72
            |..|||||:||....  ||...: |......||  ...:.....|||||||:::|.||::|||.|
  Fly    13 WQNGPAPGEFYNFTGGQTPVQQL-PRELTTMGPYGTKHSTASSTTGTSVLGIRYDSGVMLAADTL 76

Mouse    73 GSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWL 137
            .||||:||::||.|:.:||.:.:||.|||:||.|.:|:.:.|.:|:::...|.....|:::.||:
  Fly    77 VSYGSMARYQNIERVFKVNKNILLGGSGDFADIQSIKRNIDQKMIEDQCCDDNIEMKPKSLASWM 141

Mouse   138 TRAMYSRRSKMNPLWNTMVIGGY-ADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEK 201
            ||.:|:|||:||||:..:|:||. .:|..:|..||:.|.:||...:|||:..:||.||:||...|
  Fly   142 TRVLYNRRSRMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPLVREKKPK 206

Mouse   202 QPVLSQTEARELVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSAQTNWDIAHMISGF 263
            ....:..||.||:..||.||||||.|:.:::.:...:..|..:|||.....||..|..|.|:
  Fly   207 DRDFTAVEASELIRTCMEVLYYRDTRNISQYTVGVCSVNGCGVEGPFQVNENWTFAETIKGY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psmb4NP_032971.2 PRE1 45..241 CDD:223711 83/196 (42%)
proteasome_beta_type_4 52..247 CDD:239729 85/195 (44%)
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 81/191 (42%)
PRE1 60..232 CDD:223711 78/171 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845791
Domainoid 1 1.000 175 1.000 Domainoid score I3655
eggNOG 1 0.900 - - E1_KOG0185
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2090
Inparanoid 1 1.050 208 1.000 Inparanoid score I3676
Isobase 1 0.950 - 0 Normalized mean entropy S1013
OMA 1 1.010 - - QHG53720
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004376
OrthoInspector 1 1.000 - - oto94110
orthoMCL 1 0.900 - - OOG6_101718
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1012
SonicParanoid 1 1.000 - - X3101
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.