DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment his-10 and His4:CG33893

DIOPT Version :9

Sequence 1:NP_496893.1 Gene:his-10 / 191671 WormBaseID:WBGene00001884 Length:103 Species:Caenorhabditis elegans
Sequence 2:NP_001027322.1 Gene:His4:CG33893 / 3772314 FlyBaseID:FBgn0053893 Length:103 Species:Drosophila melanogaster


Alignment Length:103 Identity:101/103 - (98%)
Similarity:102/103 - (99%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65
            |:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65

 Worm    66 VIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103
            ||||||||.|||||||||||||||||||||||||||||
  Fly    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
his-10NP_496893.1 PLN00035 1..103 CDD:177669 99/101 (98%)
His4:CG33893NP_001027322.1 PLN00035 1..103 CDD:177669 99/101 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG3467
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100120
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.