DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrm-2 and scramb1

DIOPT Version :9

Sequence 1:NP_493321.1 Gene:scrm-2 / 191509 WormBaseID:WBGene00014200 Length:265 Species:Caenorhabditis elegans
Sequence 2:NP_648389.3 Gene:scramb1 / 326186 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster


Alignment Length:239 Identity:94/239 - (39%)
Similarity:140/239 - (58%) Gaps:6/239 - (2%)


- Green bases have known domain annotations that are detailed below.


 Worm    24 PGASIQAAPGAIWMEALPAIEGIPAGLEYLAYLDTVMVHQVKEVLEILTGWESKNKYAIRNKNGQ 88
            ||.:.|..|...||.....|...|.|||||..:|.::|.|..|:||..||:|:.||:.|:|..||
  Fly   171 PGMAPQGGPAGDWMSIPTGIPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQ 235

 Worm    89 QCYYAFEESNAWERQCCGSQRGFTMHIVDNFNKNVLIVKRELRCCADSFCGCLLGLQNICTIESL 153
            :.|:|.|:::...|.|||..|.|.|.:.|||.:.|:.:.|.|.|.:..|..||..::    :.:.
  Fly   236 KVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCLFPCCLQSIE----VSAP 296

 Worm   154 STGLLGTVLQGYGCTNSFYNILDKDGNLIFLVDGQGCCTSCCCEDKDFTIKTPDSSVPIGSITKK 218
            ...::||:.|.:...:..:.||:..|:.:..::|. .||...|.|.:|.:.:. :...||.|:|:
  Fly   297 PGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGP-FCTFSLCGDVEFNVVSL-TGEKIGKISKQ 359

 Worm   219 WGGLLREAFTDADTFAVTFPIDLDVKLKAILLGATFLIDFVEFE 262
            |.||.||.|||||.|.:.||:||||::||:|||||||||.:.||
  Fly   360 WSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scrm-2NP_493321.1 LOR 40..263 CDD:295149 88/223 (39%)
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887
Scramblase 184..404 CDD:252175 89/226 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 193 1.000 Domainoid score I1864
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41418
Inparanoid 1 1.050 208 1.000 Inparanoid score I2390
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28609
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm4812
orthoMCL 1 0.900 - - OOG6_100156
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1891
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.