DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klk6 and CG18420

DIOPT Version :9

Sequence 1:NP_001158168.1 Gene:Klk6 / 19144 MGIID:1343166 Length:253 Species:Mus musculus
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:235 Identity:74/235 - (31%)
Similarity:131/235 - (55%) Gaps:24/235 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse    28 KVVHGGPCLKDSHPFQAALYTSGH-LLCGGVLIDPQWVLTAAHCKKPNLQVI--LGKHNLRQTET 89
            ::|:|...:::|.|:.|.|:||.: .:|||.||..:.|||||||..||..::  ||::| |:.:.
  Fly    42 RIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYN-RKLKG 105

Mouse    90 FQRQISVDRTIVHPRYNPETHDNDIMMVHLKNPVKFSKKIQPLPLKNDCSEEN--PNCQIL---G 149
            ::.:..|:||..|..|:|.||.|||.::.|.:.|.:...|:|:.:..|.|.::  .:.::|   |
  Fly   106 YREEHQVNRTFQHRFYDPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTG 170

Mouse   150 WGKMENGDFPDTIQCADVHLVPREQCERAYPGKITQSMVCAGDMKEGNDSCQGDSGGPLVCGGRL 214
            ||:.|:......::..|:...|.:.|  |: |.:..:..|||:.  .::.|.||:|||:....|.
  Fly   171 WGRTESMHDSSELRTLDISRQPSKMC--AF-GSVLSNQFCAGNW--NSNLCIGDTGGPVGAMVRY 230

Mouse   215 RGL-------VSWGDMPCGSKEKPGVYTDVCTHIRWIQNI 247
            |..       ::..:..|   ::|.|:|||.:||.:|:.|
  Fly   231 RNAFRFVQVGIAITNKRC---QRPSVFTDVMSHIEFIRRI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klk6NP_001158168.1 Tryp_SPc 28..244 CDD:214473 72/230 (31%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 72/230 (31%)
Tryp_SPc 43..267 CDD:238113 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.