DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prss12 and CG3700

DIOPT Version :9

Sequence 1:NP_032965.1 Gene:Prss12 / 19142 MGIID:1100881 Length:761 Species:Mus musculus
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:266 Identity:79/266 - (29%)
Similarity:125/266 - (46%) Gaps:35/266 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse   517 IIGGNNSLRGAWPWQASL---RLRSAHGDGRLLCGATLLSSCWVLTAAHCF-------KRYGNN- 570
            |:||..:....:|:.|.:   |...:..|....||.:::...:|||||||.       :|...| 
  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166

Mouse   571 -SRSYAVRVG--DYHTLVPEEFEQEIGVQQIVIHRNYRPDRSDY----DIALVRLQGPGEQCARL 628
             |..:.||:|  ||::...:...|:..|...|:|..|..:..:.    |||||.|    ::.|..
  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVEL----DRKAEF 227

Mouse   629 STHVLPACLP--LWRERPQKTASNCHITGWGDTGRAY-SRTLQQAAVPLLPKRFCKERYK-GLFT 689
            :.||...|||  ...:..|.||:     |||.|.... |..|.:..:.......|::|.: .:.|
  Fly   228 NDHVAAVCLPPDSGNDVQQVTAA-----GWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDT 287

Mouse   690 GRMLCAGNLQEDNRVDSCQGDSGGPLMCEKPDESWV--VYGVTSWGYGCGVKDTPGVYTRVPAFV 752
            ....|||::  .::.|:|.||||||:..:.|....:  |.|:.|:|..||.:..|.|||:|..:.
  Fly   288 RTQFCAGSM--SSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYT 350

Mouse   753 PWIKSV 758
            .||:|:
  Fly   351 DWIESI 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prss12NP_032965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..87
KR 83..159 CDD:214527
SR 166..265 CDD:214555
SRCR 171..265 CDD:278931
SR 273..372 CDD:214555
SRCR 278..371 CDD:278931
SR 386..485 CDD:214555
SRCR 396..485 CDD:278931
Zymogen activation region 505..516
Tryp_SPc 516..755 CDD:214473 76/261 (29%)
Tryp_SPc 517..758 CDD:238113 78/264 (30%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/264 (30%)
Tryp_SPc 102..353 CDD:214473 76/261 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.